KEGG   Taeniopygia guttata (zebra finch): 115493585
Entry
115493585         CDS       T01082                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
tgu  Taeniopygia guttata (zebra finch)
SSDB
Motif
Pfam: MRAP PAG SelK_SelG MAP17
Other DBs
NCBI-GeneID: 115493585
NCBI-ProteinID: XP_032602458
LinkDB
Position
2:40173..48212
AA seq 115 aa
MANRTNSSEYFWSYEYYWDYIDPIPVDGSKLKVNKYSIVIAFWVGLAAFVTFLFLVLLCM
SCSGSTPANTTMNRNTGSGRSSLGSDCTHDNYRSQEHPGQILVQGRSTCQQHALE
NT seq 348 nt   +upstreamnt  +downstreamnt
atggctaacagaacaaactcctcggagtatttctggtcttatgaatattactgggattac
atagatccaattccagtagatggaagcaagttgaaggttaataaatactccatcgtcatt
gccttttgggtcggccttgctgcgtttgtgacgtttcttttccttgttttgctgtgtatg
tcctgctccggatcaacgccagcaaacacgacgatgaacaggaacacaggttcgggcagg
agctcattaggcagtgactgcactcacgacaattatcggtcacaagagcacccagggcaa
atcctggtgcaaggacggagtacttgccagcagcatgcattggaataa

DBGET integrated database retrieval system