Thalassospira sp. A40-3: IT893_06050 Help Entry IT893_06050       CDS       T08364                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism thai  Thalassospira sp. A40-3 Pathway thai01100   Metabolic pathways thai01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:thai00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IT893_06050   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IT893_06050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QPO13075 LinkDB All DBs Position 1348880..1349116 Genome browser AA seq 78 aa AA seqDB search MSDVADRVKKIVVEHLGVEEDKVTENASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA EKILTVKDAIDFIEKADS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgatgtcgcagatcgcgtgaagaagatcgttgtcgagcacctcggtgttgaagaa gacaaggtcactgaaaacgcaagcttcatcgacgatctgggcgcagacagcctggacacc gttgagctggttatggcgtttgaagaagaattcggttgtgaaattccggatgacgcggct gaaaaaattctgaccgttaaagacgcgatcgacttcatcgaaaaggcggacagctaa

DBGET integrated database retrieval system