Thermaerobacter sp. PB12/4term: DYI95_004720 Help Entry DYI95_004720      CDS       T06418                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism thep  Thermaerobacter sp. PB12/4term Pathway thep01100   Metabolic pathways thep01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:thep00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DYI95_004720 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DYI95_004720 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1409 DUF1896 Motif Other DBs NCBI-ProteinID:  QIA26911 UniProt:  A0A8T8D6R6 LinkDB All DBs Position 1160018..1160257 Genome browser AA seq 79 aa AA seqDB search MADEALFQRVKAIIVEQLGVDEASVTPEARFIEDLGADSLDIVELIMALEEEFDLEIPDE DAEKIATVGDAIQYIESHK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggcggacgaggcccttttccagcgggtcaaggccatcatcgtggagcagctgggggtc gatgaagccagcgtgacgcccgaagcccggttcatcgaggatctgggcgcggactcgctg gacatcgtggagctgatcatggccctcgaagaggagttcgacctggagatccccgacgag gatgccgagaagatcgccaccgtgggggatgcgatccagtacatcgagtcccacaagtga

DBGET integrated database retrieval system