Thermosipho sp. 1070: Y592_00245 Help Entry Y592_00245        CDS       T04909                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism ther  Thermosipho sp. 1070 Pathway ther02024   Quorum sensing ther03018   RNA degradation Brite KEGG Orthology (KO) [BR:ther00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     Y592_00245  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     Y592_00245  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ther03019]     Y592_00245    03036 Chromosome and associated proteins [BR:ther03036]     Y592_00245 Messenger RNA biogenesis [BR:ther03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      Y592_00245 Chromosome and associated proteins [BR:ther03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     Y592_00245 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  ANQ52980 LinkDB All DBs Position complement(52067..52342) Genome browser AA seq 91 aa AA seqDB search MAEKFNLQDRFLNILRTSKIPVKVYLVNGFQTKGIIRSFDNFTMLLENGSQQNLIYKHAV STIMPEAFVRLTSKQSQDESENNEKESNGEE NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggcggagaaatttaatttacaggataggtttttgaacattttaagaactagcaaaatt cctgtaaaagtttatttagtaaacggttttcaaactaagggtattatacgatcatttgat aattttaccatgcttttggaaaatggtagtcagcaaaatttaatttacaaacatgctgta agtactattatgcctgaggcgtttgttagattaacgagtaaacagtcgcaagatgaaagt gaaaataatgaaaaggaaagtaatggagaagaataa

DBGET integrated database retrieval system