KEGG   Thermincola potens: TherJR_2947
Entry
TherJR_2947       CDS       T01226                                 
Name
(GenBank) Tetrahydromethanopterin S-methyltransferase
  KO
K25221  [methyl-Co(III) glycine betaine-specific corrinoid protein]---tetrahydrofolate methyltransferase [EC:2.1.1.378]
Organism
tjr  Thermincola potens
Pathway
tjr00670  One carbon pool by folate
tjr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tjr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    TherJR_2947
Enzymes [BR:tjr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.378  [methyl-Co(III) glycine betaine-specific corrinoid protein]---tetrahydrofolate methyltransferase
     TherJR_2947
SSDB
Motif
Pfam: MtrH Pterin_bind SpoU_sub_bind CobD_Cbib
Other DBs
NCBI-ProteinID: ADG83777
UniProt: D5XDN1
LinkDB
Position
complement(3084508..3085428)
AA seq 306 aa
MFRFTTEQHVYDINGVKIGGQPGEYPTVLIGSMFYRGHKIVKDPQKGTFDEDAAKALLDQ
EAELSAETGNPRIVDVIGDSIEALTRHAEFVLKHTDCPILLDSVSPEIRIGALKNFAKDP
SVINRIIYNSIEENYTEEELAAIKEAGVKTAVILAFSKKHLKPSKRLELLTGDDKHEGLI
AAAKRAGIEQFLIDPGVLDVASNSWTTKAIYDVKEKFGYPGGCAPSNALYLWKKMRSKGT
PYFEVAGASVFTYPITQGGDFILYGPIANAPWVYRAVATTDAMIAYANKVVGTKLGTTEH
PLLKIF
NT seq 921 nt   +upstreamnt  +downstreamnt
gtgttcagatttacaaccgaacagcatgtatatgacatcaacggagtaaaaatcggcggt
cagccgggcgaatatcctactgttctaattggcagtatgttctaccggggacacaaaata
gttaaggacccgcagaagggtacttttgatgaggatgcagctaaagccctgcttgaccag
gaagctgaattgagcgctgaaacaggtaacccaagaattgttgatgttatcggagacagc
attgaagctttgacccggcatgcggaatttgttctcaagcataccgattgccctatcctg
ctggatagtgtaagtccggaaattcgtattggcgctctgaagaactttgccaaggaccca
tcggttattaacaggattatttataactcaattgaagagaactataccgaagaagaattg
gcggccattaaagaagcaggagtaaaaactgcagtaatacttgctttcagcaagaaacac
ctgaagccttctaagaggcttgaactactgaccggtgatgataagcatgaaggccttatc
gcggctgccaagagagccgggatagaacagttccttatcgacccgggtgttctggacgtg
gccagcaacagctggactactaaagctatttacgatgtgaaagagaagttcggttatccc
ggtggctgtgcaccgtctaacgctctttacctgtggaagaagatgcgctctaaaggcacg
ccgtactttgaagttgccggtgcgtccgtattcacttatcccatcacccagggcggagac
tttatcctttacggtccaatagcaaacgctccgtgggtataccgcgccgtagccaccacc
gatgccatgattgcttatgccaataaagtggttggcaccaagttaggtacaactgaacac
ccattactaaaaattttctaa

DBGET integrated database retrieval system