KEGG   Thermococcus kodakarensis: TK0147
Entry
TK0147            CDS       T00226                                 
Name
(GenBank) spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
tko  Thermococcus kodakarensis
Pathway
tko00270  Cysteine and methionine metabolism
tko00330  Arginine and proline metabolism
tko00480  Glutathione metabolism
tko01100  Metabolic pathways
Module
tko_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:tko00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    TK0147
   00330 Arginine and proline metabolism
    TK0147
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    TK0147
Enzymes [BR:tko01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     TK0147
SSDB
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_25 Methyltransf_30
Other DBs
NCBI-ProteinID: BAD84336
UniProt: Q5JFG9
LinkDB
Position
complement(119064..119930)
AA seq 288 aa
MGYNEQERAFIEWYPRGYGVGFKVKRRLFETQTEYQRLEIYETEGFGKLLVLDGTVQLVE
VGEESYHEVLVHPVMLAHPNPRKVLVIGGGDGGTLREVLRHDTVEKAIMVEIDEGVVEAS
YLYLDVAKDLLDRLIKKEEPRAELIIGDGVKYLRETDERFDVIIVDSTDPVGPAKLLFSE
EFYRDAYEKLNEKGLYVTQAGSVYLFTNELLDAYKAMKKVFDRVYYFSFPVIGYASPWSF
LVGVKGDVDFTRIDLERAKKLDLYYYDPERHETLFQMPRYVRKLLEGQ
NT seq 867 nt   +upstreamnt  +downstreamnt
atgggatacaacgagcaggagagggctttcatcgaatggtaccctcgcggctacggagtc
gggtttaaggtgaagaggagactgtttgagacccagacggaataccagcgtcttgagata
tacgagacggagggctttgggaagctccttgtcctggatggaaccgtccaacttgtggag
gttggtgaggagagctatcacgaagtcctggtacaccctgtaatgcttgcacacccgaac
ccgaggaaggttctcgtcatcggcggtggagacggtggaacgctccgcgaggttcttagg
catgacaccgttgagaaggccataatggtggagatagacgagggtgttgtggaagcgtct
tacctctaccttgacgtcgccaaagaccttttggacaggctcataaagaaggaagagcca
cgggccgagctgataatcggcgacggcgtcaagtacctcagggaaactgatgaacgcttc
gacgttataatcgtggactcaaccgatccagtcggccccgcgaagcttctcttcagcgaa
gagttttacagggacgcctacgagaagctgaacgagaagggtctttacgttacccaggcc
ggcagcgtttacttgttcacgaacgagctcctcgacgcgtataaggccatgaagaaagtc
tttgacagggtgtactacttcagcttcccggtaataggctacgcctcgccctggagcttc
ctcgttggggtcaagggagacgttgacttcaccaggatagaccttgagagggcaaagaag
ctcgacctctactactacgatcccgagaggcacgaaaccctcttccagatgccgcgctac
gtcagaaagctcctagaggggcagtaa

DBGET integrated database retrieval system