Talaromyces marneffei: EYB26_001788 Help Entry EYB26_001788      CDS       T06392                                  Name (RefSeq) uncharacterized protein   KO K03016   DNA-directed RNA polymerases I, II, and III subunit RPABC3 Organism tmf  Talaromyces marneffei Pathway tmf03020   RNA polymerase tmf03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:tmf00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     EYB26_001788   09124 Replication and repair    03420 Nucleotide excision repair     EYB26_001788  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:tmf03021]     EYB26_001788    03400 DNA repair and recombination proteins [BR:tmf03400]     EYB26_001788 Transcription machinery [BR:tmf03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      EYB26_001788   RNA polymerase III system    RNA polymerase III      EYB26_001788   RNA polymerase I system    RNA polymerase I      EYB26_001788 DNA repair and recombination proteins [BR:tmf03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       EYB26_001788 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb8 Motif Other DBs NCBI-GeneID:  79161761 NCBI-ProteinID:  XP_054117071 LinkDB All DBs Position 1:join(4861532..4861869,4861941..4862046) Genome browser AA seq 147 aa AA seqDB search MSDAQLFEDTFTITSINSQKYDRVSRISCTSTDNLTTFTLDVNTELYPCAVGESLSMALA STLSLDGKDEDASAGRGGWRDVGMGEHTLANEYDYVCHGKVYRFEEGSTQGNMSVFVSFG GLLLYMDGPYNKLVPLRIDYVYLLIKK NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgtcggacgctcagctctttgaagacactttcacaatcacctcgataaactcgcagaaa tatgatcgcgtttctcgtatcagctgtacatcaacagacaacttgaccacattcacactt gatgtgaacacggaactgtacccttgcgcagtcggcgaatcgctctccatggctctagcc tcgaccctgtctctggacggaaaggatgaagatgccagcgcgggtcgaggtggttggaga gatgttggtatgggcgagcatactcttgccaatgagtatgactatgtctgccatggaaaa gtctatcgattcgaggaaggttctactcagggaaatatgtccgtctttgtctccttcggt ggtcttttgctgtacatggatggcccatacaacaagcttgtccccttgaggatcgactac gtttatctgttgatcaagaaatag

DBGET integrated database retrieval system