KEGG   Talaromyces marneffei: PMAA_031310
Entry
PMAA_031310       CDS       T06392                                 
Name
(RefSeq) dimethylallyl tryptophan synthase SirD-like, putative
  KO
K21339  4-O-dimethylallyl-L-tyrosine synthase [EC:2.5.1.122]
Organism
tmf  Talaromyces marneffei
Brite
KEGG Orthology (KO) [BR:tmf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PMAA_031310
Enzymes [BR:tmf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.122  4-O-dimethylallyl-L-tyrosine synthase
     PMAA_031310
SSDB
Motif
Pfam: Trp_DMAT
Other DBs
NCBI-GeneID: 7022581
NCBI-ProteinID: XP_002144832
UniProt: B6Q4S8
LinkDB
Position
Unknown
AA seq 460 aa
MDFLRAVGEWLVSTLFLLKQGMKCIKRDTSPDEGYNAKYNWDRHLWCRDVGSILEYMLAM
AGYTDESQEFHYQFFARYIAESFGQHPTTTALPLEEKNKSFMTDDHTPIELSWKWSASHK
LPTVRYSIDPVPAELDTFNTRATNELVEKILPSSSFVDLRWYDKLVDMLTTPTSDTDGEK
LLQSDIASSSKLPHSQEFLAFDLEKRIKNNSRNIMLKAYFLPQWKALLNAESTFSLVQSS
IKTLSASQPDTLLYESWNLVADYIQSFNSDNGRPQVEMTALDCIDPSQSRIKIYLRSSRT
KFNDVLDMMTLGGRISTHIQGELLESLKSIWCSVLSLEEKELDTDLPVNNHRTAGILYLA
ELRPGRPVPKIKVYIPAKHYGKNDLCVAQGISRYLTSRAHAFADGNDYLTGVKRLCHHRN
LEDGLGFHTYVSVAVDKSGLDVTTYFNPEIYHESRRLPTE
NT seq 1383 nt   +upstreamnt  +downstreamnt
atggatttcctgcgtgccgtaggagaatggcttgtctccacactctttttactcaaacag
ggaatgaaatgtatcaaaagggatacttcgccagatgaaggatacaacgcaaaatataat
tgggacagacacctttggtgccgagatgtcggcagcattctagagtatatgctcgcaatg
gctgggtatacggatgaatcgcaagaattccattaccaattttttgcccgttacatcgcg
gagtcatttggccaacaccctacgacgacagctctaccactagaagaaaagaataagtcc
ttcatgacggatgatcatactcccatcgaattgagctggaaatggtcggcatcacataaa
ctgccgacggtacgatactcaattgatccggtccctgcagagctggacacctttaataca
cgtgcgacaaatgagctcgtggaaaagatactaccttcctccagcttcgttgatcttcgc
tggtatgataagcttgtagacatgctcactacccctacttctgacacggatggggaaaag
cttctacaatctgatatcgcatcatcatcaaagctgccgcattcgcaggagttcttggcg
tttgatctggagaagaggatcaaaaacaacagcagaaatatcatgctaaaggcatacttt
ctcccgcaatggaaagcccttctaaatgccgaatccaccttctccctcgtacaatccagc
atcaaaaccctatccgcatcccaacccgatactctactatacgaatcatggaatctggta
gcagactatatccaatctttcaactccgataatggacgaccacaagtcgaaatgacagca
ctcgattgcattgatccatcccaatcacgcatcaagatctatctccgctcttcccgcaca
aaatttaacgatgttcttgatatgatgactcttggaggccggatatccactcatatccaa
ggcgaactgttggaatcactgaaatcaatatggtgctctgttctgagtctagaggaaaag
gagttggatacagatctcccggtaaacaaccatcgaacagcagggatcttgtatttggcg
gaactgaggcctgggcgtcccgttcccaaaatcaaggtttatattccagccaaacattat
ggaaagaatgatctgtgtgtggcgcaggggatatcaaggtaccttactagcagggcgcat
gcttttgctgatgggaatgactatttgactggggtgaagcggctttgccatcatcgcaac
ctcgaggatggtttaggttttcatacatatgtatccgttgcagtcgataaaagcgggttg
gatgtcactacatacttcaatccggaaatctatcacgagtcgcgaagattacctaccgag
tga

DBGET integrated database retrieval system