Tuber melanosporum: GSTUM_00008643001 Help Entry GSTUM_00008643001 CDS       T01282                                  Name (RefSeq) hypothetical protein   KO K10845   TFIIH basal transcription factor complex TTD-A subunit Organism tml  Tuber melanosporum Pathway tml03022   Basal transcription factors tml03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:tml00001]  09120 Genetic Information Processing   09121 Transcription    03022 Basal transcription factors     GSTUM_00008643001   09124 Replication and repair    03420 Nucleotide excision repair     GSTUM_00008643001  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:tml03021]     GSTUM_00008643001    03400 DNA repair and recombination proteins [BR:tml03400]     GSTUM_00008643001 Transcription machinery [BR:tml03021]  Eukaryotic type   RNA polymerase II system    Basal transcription factors     TFIIH      GSTUM_00008643001 DNA repair and recombination proteins [BR:tml03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TFIIH complex      GSTUM_00008643001 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tfb5 Peptidase_C39 Motif Other DBs NCBI-GeneID:  9185633 NCBI-ProteinID:  XP_002840224 INRA:  GSTUM_00008643001 UniProt:  D5GIS2 LinkDB All DBs AA seq 83 aa AA seqDB search MPRAVKEIHQSTGVLIECDPSIKAIILKIDKDSGHGYIVEDLDDETLVVKEPKLAELKLR LEKILERTQMLEKDEESDPENPG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgcccagagcggtgaaagaaatccaccaatccacaggcgtcctaatcgaatgcgacccc tccatcaaagccataattctcaagatcgataaggattctggtcacgggtatattgtcgag gacctcgacgatgagacgctggtggtgaaggagccgaagctggcggagctgaagttgcgg ctggagaagattctggagagaacgcagatgctggagaaggatgaggagagcgaccctgag aatccgggctag

DBGET integrated database retrieval system