Tremella mesenterica: TREMEDRAFT_29558 Help Entry TREMEDRAFT_29558  CDS       T03139                                  Name (RefSeq) hypothetical protein   KO K10845   TFIIH basal transcription factor complex TTD-A subunit Organism tms  Tremella mesenterica Pathway tms03022   Basal transcription factors tms03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:tms00001]  09120 Genetic Information Processing   09121 Transcription    03022 Basal transcription factors     TREMEDRAFT_29558   09124 Replication and repair    03420 Nucleotide excision repair     TREMEDRAFT_29558  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:tms03021]     TREMEDRAFT_29558    03400 DNA repair and recombination proteins [BR:tms03400]     TREMEDRAFT_29558 Transcription machinery [BR:tms03021]  Eukaryotic type   RNA polymerase II system    Basal transcription factors     TFIIH      TREMEDRAFT_29558 DNA repair and recombination proteins [BR:tms03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TFIIH complex      TREMEDRAFT_29558 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tfb5 PSV_ORF131-like_dom Motif Other DBs NCBI-GeneID:  18492006 NCBI-ProteinID:  XP_007003837 JGI:  Treme1_29558 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MSTYSDPYAVKLTSGVLITCDSAAKQILLHIDSQRDGPSKFILRDIDETHVLVKKEHIEI MKDLLQVEVSFLS NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgagcacttattccgatccatatgctgtcaagctaacttccggcgttctgatcacttgt gactcggcagctaaacaaatattattacatatcgattctcaacgcgacggaccgagtaaa ttcattttacgggatatcgatgaaacacacgttttggtcaagaaagaacatattgaaatt atgaaagatcttcttcaagttgaagtcagttttctctcttga

DBGET integrated database retrieval system