Thermoanaerobacter mathranii: Tmath_0692 Help Entry Tmath_0692        CDS       T01250                                  Name (GenBank) ATP synthase F0, C subunit   KO K02110   F-type H+-transporting ATPase subunit c Organism tmt  Thermoanaerobacter mathranii Pathway tmt00190   Oxidative phosphorylation tmt01100   Metabolic pathways Module tmt_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:tmt00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Tmath_0692  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:tmt00194]     Tmath_0692 Photosynthesis proteins [BR:tmt00194]  Photosystem and electron transport system   F-type ATPase [OT]    Tmath_0692 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  ADH60439 UniProt:  A0ABM5LP08 LinkDB All DBs Position 724197..724418 Genome browser AA seq 73 aa AA seqDB search MDLTVIGAGIAALTGIGAGIGIGIATGKAVEAVARQPEAGGRIMQLLLLGGALAEATAIY GLLVAFLIIILKP NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atggatttgacagttattggcgcaggtattgctgcattaacaggtataggagcaggtatt ggtataggtattgctacagggaaggcagtagaggctgtggcaaggcaacccgaagcaggt gggaggattatgcagcttcttttattaggtggcgctcttgctgaggcgacagccatttat ggcttactggtagcattcctcataataatattaaagccataa

DBGET integrated database retrieval system