KEGG   Trichechus manatus latirostris (Florida manatee): 101359144
Entry
101359144         CDS       T05135                                 
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04927  Cortisol synthesis and secretion
tmu04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    101359144
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101359144
SSDB
Motif
Pfam: MRAP FixQ
Other DBs
NCBI-GeneID: 101359144
NCBI-ProteinID: XP_004387044
UniProt: A0A2Y9E4Z0
LinkDB
Position
Unknown
AA seq 156 aa
MANETNSSAPSYSYEYYLDYLDLIPVDEKKLRANKHSIVIAFWVSLAAFVVLLFLILLYA
SWSGSPQMRNHPQHHPTCPWHHFLNLPPRVRRHPRRHSGPPGTPLAPSSEEEPGRGSGSE
QPLQPGGPSASAPSASQTLPAFLWELARDGGPHGIS
NT seq 471 nt   +upstreamnt  +downstreamnt
atggccaacgagaccaactcctcggccccgtcctacagctatgagtactacctggactac
ctggacctcattcctgtggacgagaagaagctgagagccaacaagcattcgattgtcatt
gccttttgggtgagcctggctgccttcgtggtgctcctcttcctcatcttgctctacgcg
tcctggtcaggctcccctcagatgaggaaccacccccagcaccacccaacctgtccgtgg
catcacttcctcaacctccccccccgcgtccggaggcacccacggcgccacagtggcccg
ccggggacccccctggctcccagctcggaagaggaaccaggaagaggctccggatctgag
cagccgctgcaaccagggggcccctccgcctcggccccctccgcctcccagaccctccct
gctttcctctgggaactggcccgtgatgggggcccccatggcatcagctga

DBGET integrated database retrieval system