KEGG   Trichoplusia ni (cabbage looper): 113504562
Entry
113504562         CDS       T05757                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
tnl  Trichoplusia ni (cabbage looper)
Pathway
tnl00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:tnl00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    113504562
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:tnl00199]
    113504562
Enzymes [BR:tnl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     113504562
Cytochrome P450 [BR:tnl00199]
 Cytochrome P450, animal type
  CYP306 family
   113504562
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 113504562
NCBI-ProteinID: XP_026742725
UniProt: A0A7E5WPN3
LinkDB
Position
22:1118599..1125466
AA seq 539 aa
MDFFFLWLVTFVAGFWIFKKLKQWQSLPPGPWGLPVVGYLPFLDRYQPHLTLTKLSKEYG
PIYGIGMGSVYAVVLSDHKLVRDAFAKENFSGRAPLYLTHGIMRGNGIICAEGALWKDQR
KLITTWLKSFGMSKHSVSREKLEKRIASGVYELLENVEKASGSPMDLPRMLSNSLGNVIN
EIIFGFKFPPEDKTWHWFRQIQEEGCHEMGVAGVVNFLPFIRFISSSTRKTMDILTRGQA
QTHRLYASIIERRRRMLELTPPKEAAYALHDNLFNEHPEGHIKCVKYSKHALSNEEHYFD
PKILIPSDGDCILDNFLAEQKRRFDKGEEAAKFMTDEQMLFLLADMFGAGLDTTSVTLSW
FLLYMALYPDEQELVRKEILSVYPDDGEIDGSMLPYLSAAICETQRIRSIVPVGIPHGCL
EDTYIGNYRIPKGTMVIPLQWAIHMDPNVWEDPEEFRPSRFLAPDGSLIKPPEFIPFQTG
KRMCPGDELSRMLASGLVARLFRRRRVRLASDPPSAEDMRGTVGVTLAPPPVLFYCDSV
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggattttttctttttatggctggtcacgttcgtcgctggattttggatttttaaaaaa
ctaaaacaatggcagagtctaccgcctggtccttggggcctgccagtggtcggctatttg
ccgttcctagatcgctatcagccacatttgactctgactaaactgtccaaggagtatggc
ccgatatatgggattggtatgggcagtgtgtatgctgtcgtgttatcagatcataagcta
gtgagagacgcttttgctaaggagaacttttctgggagagcacctttgtacttaactcat
gggataatgcgaggaaacggtattatttgtgcggagggagctttatggaaggatcaaaga
aagctgataacaacgtggctgaaaagtttcggcatgagtaaacacagtgtgtcgcgggaa
aagttggaaaagcgaatcgcctcaggggtctacgaactcttagaaaatgtcgaaaaggct
tccggttcaccgatggatctccctcgaatgttatcaaactctttaggaaatgtgatcaac
gaaattatattcgggttcaagttccctcccgaagataaaacatggcactggttcaggcaa
attcaagaagaaggctgtcacgaaatgggtgtcgctggcgtcgttaactttttacctttt
attcggttcatttcatcctcaactcgaaaaacaatggatattctgacacgtggtcaagcg
caaacacacaggctatatgcaagtatcattgaacgacgacgtagaatgcttgaactgacg
ccgccaaaggaagcggcgtacgccctgcatgacaatctgtttaacgagcatccagagggc
catataaaatgcgttaagtacagcaagcacgcgcttagtaacgaagaacattacttcgat
ccgaagatcttaatcccatcggacggggattgtatccttgacaattttctcgctgaacaa
aaacgaaggttcgacaaaggggaggaagcagccaagttcatgacagatgaacagatgctt
ttcctactagcggacatgtttggggctggcctcgatacaacctccgtaactctatcatgg
ttcttattatacatggccctttatccagacgaacaggaactagtacgcaaagaaatccta
tcggtttaccccgatgacggggaaatagatggatccatgctgccttacctcagcgctgcg
atatgcgagacccaacgcatacgatcgatcgtgcccgtcgggattccccatggatgtctc
gaagatacgtacataggaaactacagaatcccaaaaggcacaatggtgataccgttacaa
tgggccatacatatggatccgaacgtgtgggaggatcctgaagaattcaggccgagcaga
ttcctagcgcctgatggaagcctgattaaacctccagaatttataccgtttcagacaggc
aaacgcatgtgtcccggcgacgagttatcccgaatgctcgcgagcggtttagtcgcgcga
ctatttcgtcgcaggcgcgtgcggcttgcctcggacccgccgtccgccgaagacatgcgg
ggtacagtcggagtgaccctcgccccgcccccggtcctcttttattgcgactctgtataa

DBGET integrated database retrieval system