Tolypothrix sp. PCC 7601: HG267_26320 Help Entry HG267_26320       CDS       T11260                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism toi  Tolypothrix sp. PCC 7601 Pathway toi00261   Monobactam biosynthesis toi01100   Metabolic pathways toi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:toi00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HG267_26320  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:toi01008]     HG267_26320 Polyketide biosynthesis proteins [BR:toi01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HG267_26320 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UYD32516 LinkDB All DBs Position complement(6510803..6511033) Genome browser AA seq 76 aa AA seqDB search MNQTTSEDTTIYKVVVNHEEQYSIWPADRENALGWKDAGKSGLKSECLEYIKEVWTDMRP LSLRKKMEETSSKNSV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgaaccaaacaacttcagaagatacaaccatttataaagttgtagttaaccatgaggaa caatattctatttggcctgctgaccgggaaaatgctcttgggtggaaagatgcagggaaa agtgggctgaaatcagaatgtttggaatacattaaggaagtttggactgatatgcgaccc ctaagcttaagaaagaaaatggaggaaacatctagcaaaaattcagtataa

DBGET integrated database retrieval system