Thermus oshimai: Theos_0685 Help Entry Theos_0685        CDS       T02346                                  Name (GenBank) hypothetical protein   KO K18997   chaperone modulatory protein CbpM Organism tos  Thermus oshimai Brite KEGG Orthology (KO) [BR:tos00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tos03036]     Theos_0685 Chromosome and associated proteins [BR:tos03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     Theos_0685 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MerR_2 MerR_1 HTH_17 Motif Other DBs NCBI-ProteinID:  AFV75747 UniProt:  K7RGP4 LinkDB All DBs Position 630283..630519 Genome browser AA seq 78 aa AA seqDB search MLARSAFLSLEALEAYGLSLGAVRAYVEIGFVEPVEVEGRWYFREADLLRMAKAERIRRD LGANLIGAALVVEILERS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgctcgcgcgtagcgctttcctctccctggaggccctggaggcctacggcctctccttg ggggcggtgcgggcctacgtggagatcggcttcgtggagcccgtggaggtggaggggcgg tggtacttccgggaggccgatctcctgcgcatggccaaggcggagcgcatccgccgcgat ctaggggccaacctcatcggggcggccttggtggtggagatcctggagcgttcctag

DBGET integrated database retrieval system