Thermus parvatiensis: AV541_03315 Help Entry AV541_03315       CDS       T04274                                  Name (GenBank) dafA   KO K18997   chaperone modulatory protein CbpM Organism tpar  Thermus parvatiensis Brite KEGG Orthology (KO) [BR:tpar00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tpar03036]     AV541_03315 Chromosome and associated proteins [BR:tpar03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     AV541_03315 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MerR_2 MerR_1 HTH_17 Motif Other DBs NCBI-ProteinID:  AMA75288 UniProt:  H7GHD7 LinkDB All DBs Position 576900..577136 Genome browser AA seq 78 aa AA seqDB search MLARSEWVSLEALEAYGLSLGAVRAYVEIGFVEPLEVGGSWYFREADLLRMAKAERIRKD LGANLIGAALVVEILERR NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgctcgcgcgtagcgagtgggtttccctcgaggccttggaggcctacggcctttcccta ggggcggtgcgggcctacgtggagatcggcttcgtggagcccttggaggtaggggggagc tggtacttccgcgaggccgaccttcttcgcatggccaaggccgaacgcatccgcaaggac ctcggagccaacctcatcggggcggccctggtggtggagatcctggaacgtcgctag

DBGET integrated database retrieval system