KEGG   Tetrapisispora phaffii: TPHA_0D01100
Entry
TPHA_0D01100      CDS       T02235                                 
Symbol
TPHA0D01100
Name
(RefSeq) hypothetical protein
  KO
K12414  DNA replication licensing factor, required for pre-replication complex assembly
Organism
tpf  Tetrapisispora phaffii
Pathway
tpf04111  Cell cycle - yeast
tpf04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:tpf00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    TPHA_0D01100 (TPHA0D01100)
   04113 Meiosis - yeast
    TPHA_0D01100 (TPHA0D01100)
SSDB
Motif
Pfam: CDT1_C
Other DBs
NCBI-GeneID: 11534143
NCBI-ProteinID: XP_003685185
UniProt: G8BSD0
LinkDB
Position
4:231436..233298
AA seq 620 aa
MNSKERRLPIIDLNKISDEQELLPIIRSILLRNDTFLIKNFANRNIIDGLLDDLSQTLPD
LNQGFDSNFTGTIKLPDYSDDIHVEQYIFNTDTTIQFNRECENIALRKLYNRLFRLSLFL
SSVCLKSIGPEFEKLISEEAYSTKLTRYYLDSEYNRKVNENEDNRLDINDILPYDILVES
MFSQTYELFNSSGIISIFPVASEIMYKPQTVSVSDNTNWANVSDTDSILVHSGELLSILS
GNLYTTSPLKINYGFNKLVHLTFYPPLSTPINYNGKETTVNDILFENQIKEFPIVADKFY
KSKVMLNALVEKLNFYKRLFTTAEAVLSLYLLSKSTGASPELHSILPQMTNMMAAKITEE
SFLRMLSIWPEAYTLSNNSNQELTVDIPKLNPLATLTSKSRKLDFVHHAEKWLQKHKTSE
PIPSDVPILKYNKRRLSDSNTKKQKTPDLRNGKTVENLKTSNLSSNDNNKRQYLHNTREE
LEFKEREVSSQSDLLKKIRAKSKRSEALLEQRQRQYEQFLAVKMRHILKIISSLPWDKPY
TITSLTSLIVDSLQDSNNPIGLTETEDILLRFQKLIPDMMGIYSVAGGLKVFKWSYLDKE
LVEKRLEDFKKIKTILVWNK
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgaattctaaagagaggaggttacccattattgatctcaataaaatatctgatgaacaa
gaacttcttcctattattagatcaattctgttgagaaacgatacttttttaattaagaat
tttgctaatagaaatataattgatggtttattggatgacttaagtcaaactcttcctgat
ttaaatcaaggttttgattctaattttacagggaccataaagttacctgactacagtgat
gacatacatgtggaacaatacatttttaatacagatactacaatacaatttaatagagaa
tgtgaaaatattgctttaagaaaattatataataggctttttagactttcattgtttttg
agttcagtgtgcttgaaaagtattggtcctgaatttgagaagctaatatctgaggaggca
tacagtacaaaattaaccagatattatttggacagtgaatacaataggaaagtaaatgaa
aatgaagataatagattagatattaatgatattctgccttatgatatattagtggaatcg
atgttttcacaaacatatgaactattcaactcatcaggaataataagcattttcccagtt
gcatcagaaattatgtataaaccccagacagttagtgtatcagataatacaaattgggct
aatgtaagtgatactgattcgatattagtacactcaggagaactgttatcaattctatct
ggcaatttgtatacaacatcgcctttaaaaattaattacggctttaataaattagttcat
ttgacattttatcctcctttaagtacaccaataaattataatggaaaggaaacaactgtt
aatgatattttgtttgaaaaccaaataaaagaatttcccatagttgctgataaattttat
aaaagtaaagtaatgcttaatgcattagttgaaaaacttaacttttataaaaggctattc
acaactgcagaggcagtgttatcattatatttactttctaaaagtacaggtgcctctcct
gaacttcattcgatattacctcaaatgaccaacatgatggctgctaaaattactgaagaa
tcttttttaaggatgttgagtatttggccagaagcctatactctatcaaataatagtaat
caggaacttacagttgatatacctaaattgaacccattggcaactttgactagtaaatct
aggaaattagattttgttcatcacgctgagaaatggttacaaaagcataaaacaagtgaa
cctatcccatcagatgttcctattttaaaatataataaaagaagacttagtgactctaat
actaaaaaacagaagactccagatttgaggaatggaaaaacagttgaaaatttgaaaact
tctaacctcagttctaatgataataataaacgtcaatatcttcataatacacgagaagaa
ctggagtttaaggaaagggaagtttcatctcaatcagatcttctaaaaaagattagagca
aaatccaagagatcagaagctttattagaacaaagacaacgtcaatatgagcagttttta
gctgtgaaaatgagacacattcttaaaattatttccagcctaccttgggacaaaccatac
actatcacaagtttaacttcattaattgtagatagtttacaagatagtaataaccctatt
ggcttaacggaaacggaagatatattgcttagatttcaaaaattaattccagatatgatg
ggaatctattcagttgctggtgggttaaaggtatttaagtggtcttatttagacaaagaa
ttggtcgaaaaaagattagaagatttcaaaaaaataaaaactatattggtatggaataaa
taa

DBGET integrated database retrieval system