KEGG   Talaromyces rugulosus: TRUGW13939_02411
Entry
TRUGW13939_02411  CDS       T06879                                 

Name
(RefSeq) uncharacterized protein
  KO
K23668  fumiquinazoline A oxidase [EC:1.5.3.-]
Organism
trg  Talaromyces rugulosus
Pathway
trg01100  Metabolic pathways
trg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:trg00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    TRUGW13939_02411
Enzymes [BR:trg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.-  
     TRUGW13939_02411
SSDB
Motif
Pfam: FAD_binding_4 BBE Indigoidine_A FAD_binding_5
Other DBs
NCBI-GeneID: 55989920
NCBI-ProteinID: XP_035341498
LinkDB
Position
I:complement(join(7083698..7083956,7084013..7084380,7084482..7084888,7084948..7085164,7085221..7085454))
AA seq 494 aa
MLSHLSFLLALPLLAATQSPNTVNLTETFRPALSDEAEIYSVNDPNWTTETTQRWSNWDA
PTYIGAIKPATEQDVAATVKIASRYNIPFLATGGGHGGSQNLATVKNAISIDLSNFNTIQ
VDAENNTVTIGGGVTYGDLYDPLYSIGKEIHFQKFTATGNARCVGVVGATIGAGVGLLQG
IRGYTSDALLQVTIVTAAGIPFNASATENSDLFWAIRGAGANFGIITSATYEIYDATNGG
HAQNANLVYPAATNGSIWDILESFDETLPAELSITIGVSYNQTTQEASIGVNLVYWGSQE
NFAQYINQFIALDPISWTNETLPWNHLTDAADREAACVTDLHVNFYSIALNQTNSQVFYG
FFTDFITFSQENPTYGGTFGIERYSAEGPMSAPAERRGVYPWRETKINLLFENIYPTNET
LDTVVDGFYTQQRQHFDELSGFPTFATYINYAHGDEGPNAWYGDDDNLERLITLKRKWDS
NNLFGAAKPIPLNK
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgttgtctcatctttcgttcttacttgcgctgccactcttggccgcaacgcaaagtccc
aatactgttaatttaaccgagacttttcgtccagccttatcagacgaagctgagatatac
agcgtcaacgacccgaactggaccacggaaacaacacaacgttggtccaactgggatgcg
ccgacctacattggggctatcaagcctgcaacggaacaagatgtagccgcaacggtgaaa
attgcgtcccgatataatatcccgtttcttgccaccggtggtggccacggtggatcgcaa
aacttagctacagtgaaaaacgcaattagcatcgatctgtcaaacttcaacactatacaa
gttgatgcggaaaacaatactgtaactattggtggtggtgtgacttacggtgacctctat
gatccgttgtacagtatcggaaaggaaattcatttccaaaaattcacagctaccggaaat
gcacgatgtgtcggggttgtcggcgcaaccatcggcgcaggcgtaggcttgctacagggt
atccgtggctatacatccgatgctttgctccaggtgaccatcgtgactgcagctgggata
ccctttaatgcatcagctacagagaattcggatctattttgggccatacgaggtgcagga
gcaaatttcggcatcatcacatcagcgacgtatgaaatatacgacgcgacaaatggtgga
cacgctcagaacgccaatttggtgtatccggcagcgacgaatgggtctatctgggacatt
ctagagtcatttgatgagacacttccagccgagttatcgatcactatcggtgtgtcatac
aaccaaaccactcaggaggcctcgatcggagtaaacctcgtatactggggctctcaagag
aacttcgcgcaatatataaaccaatttattgcactcgatccaatctcatggaccaatgag
accttaccttggaatcacttgacggacgccgcagaccgtgaagcagcatgcgtgacagac
ctacatgttaacttctactctatcgccctgaaccaaaccaattcccaggtgttttacgga
ttttttaccgatttcatcaccttttcccaagagaatcccacatacggtggtacttttgga
attgagcgatacagtgcagaaggcccaatgtcggcgcctgcagaacgacgaggtgtttat
ccctggcgagagactaaaattaacctactgtttgagaatatctatccgaccaatgagacc
ctagacaccgtagtagacggtttctacacacagcaacgtcaacactttgacgagcttagt
ggctttcctacattcgcaacatatatcaattatgctcacggcgatgaaggaccaaatgca
tggtatggagacgatgataacttagagcgtttaattacattgaaacggaagtgggattcg
aataatttgtttggagcggcgaagccaatcccgctgaacaaatga

DBGET integrated database retrieval system