Trichomycterus rosablanca: 134321792 Help Entry 134321792         CDS       T09921                                  Symbol tmem258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism trn  Trichomycterus rosablanca Pathway trn00510   N-Glycan biosynthesis trn00513   Various types of N-glycan biosynthesis trn04141   Protein processing in endoplasmic reticulum Module trn_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:trn00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     134321792 (tmem258)    00513 Various types of N-glycan biosynthesis     134321792 (tmem258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     134321792 (tmem258) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Motif Other DBs NCBI-GeneID:  134321792 NCBI-ProteinID:  XP_062859685 LinkDB All DBs Position 1:complement(46589899..46593658) Genome browser AA seq 79 aa AA seqDB search MELEAMTRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDVYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctggaagccatgacaagatacacaagtccggtaaacccggctgtgtttccccat ctaacggtggtgctgctggcaatcggcatgttcttcacagcatggttctttgtctatgag gtaacatcaacaaaatacacacgagatgtatacaaggagctgctcatctcactggtcgca tcactcttcatggggtttggagttctcttcttgctactttgggttggaatatatgtctga

DBGET integrated database retrieval system