Triplophysa rosa: 130561055 Help Entry 130561055         CDS       T09216                                  Name (RefSeq) insulin   KO K04526   insulin Organism tros  Triplophysa rosa Pathway tros04010   MAPK signaling pathway tros04068   FoxO signaling pathway tros04081   Hormone signaling tros04114   Oocyte meiosis tros04140   Autophagy - animal tros04150   mTOR signaling pathway tros04810   Regulation of actin cytoskeleton tros04910   Insulin signaling pathway tros04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:tros00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     130561055    04068 FoxO signaling pathway     130561055    04150 mTOR signaling pathway     130561055   09133 Signaling molecules and interaction    04081 Hormone signaling     130561055  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     130561055   09143 Cell growth and death    04114 Oocyte meiosis     130561055   09142 Cell motility    04810 Regulation of actin cytoskeleton     130561055  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     130561055    04914 Progesterone-mediated oocyte maturation     130561055  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tros04052]     130561055 Cytokines and neuropeptides [BR:tros04052]  Neuropeptides   Unclassified    130561055 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin HoxA13_N Motif Other DBs NCBI-GeneID:  130561055 NCBI-ProteinID:  XP_057201134 LinkDB All DBs Position LG11:12595773..12596587 Genome browser AA seq 113 aa AA seqDB search MLKSEILLLSLCAGSLVTHSGAFGNRRLCGMQLVEALLLVCGKKGVFYQPGRRVREHNTR VMMRKSALFRRHAAVAVQRGDTYASRDVSKRGIVEQCCLLYCDYYDLENYCNT NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgctcaaatctgaaattcttcttttgtcactgtgtgccggctctctggtgacacatagt ggtgctttcggtaacagaaggctatgtggcatgcagctagtggaagcgctgctgctcgtc tgtggtaaaaagggtgttttctaccagcccgggaggcgtgtcagagaacacaacactcgc gtcatgatgaggaaaagcgccctcttccggcgacacgctgcagtggctgtgcagagagga gacacgtatgccagtagagacgtttcaaagagaggcattgtagagcagtgctgtcttctt tactgtgattactatgatctggagaattactgcaatacatag

DBGET integrated database retrieval system