KEGG   Trachemys scripta elegans (red-eared slider): 117889453
Entry
117889453         CDS       T07347                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
tst  Trachemys scripta elegans (red-eared slider)
SSDB
Motif
Pfam: MRAP FixQ
Other DBs
NCBI-GeneID: 117889453
NCBI-ProteinID: XP_034649563
LinkDB
Position
1:184541407..184558185
AA seq 123 aa
MAIRTNSSEYYWSYEYYWDYLDPVPVDERKLKANKYSIVIAFWVGIAAFVVFLFLILLYM
SRSGSTPVKQVFAGNRIEHLEGSSSNVERLHCDDLNSPDSDLIATEPCNSLSDEIVIHGS
ISA
NT seq 372 nt   +upstreamnt  +downstreamnt
atggctatcagaacaaactcatctgagtattattggtcttatgaatattactgggactat
ttggatccagttcctgtagatgaaaggaagttgaaggctaataaatattcaattgtcata
gccttttgggttggtattgctgcatttgtggtgtttctgttccttatattgctctacatg
tcccgatctgggtctacaccagtcaaacaagtgtttgcaggtaaccgaatagaacatctg
gaaggaagtagctccaatgttgagcggctgcattgtgatgatctcaacagtccagactca
gacttgatcgctactgaaccatgtaattctctttcagatgaaattgttattcatggaagc
atctcggcttga

DBGET integrated database retrieval system