Tepidimonas taiwanensis: LCC91_04120 Help Entry LCC91_04120       CDS       T07546                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism ttw  Tepidimonas taiwanensis Pathway ttw02024   Quorum sensing ttw03018   RNA degradation Brite KEGG Orthology (KO) [BR:ttw00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     LCC91_04120 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     LCC91_04120 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ttw03019]     LCC91_04120 (hfq)    03036 Chromosome and associated proteins [BR:ttw03036]     LCC91_04120 (hfq) Messenger RNA biogenesis [BR:ttw03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      LCC91_04120 (hfq) Chromosome and associated proteins [BR:ttw03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     LCC91_04120 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  UBQ06293 LinkDB All DBs Position 893825..894079 Genome browser AA seq 84 aa AA seqDB search MSNNKGQLLQDPFLNQLRREHVPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQMVYKHA ISTIVPGRPVHFTVGQPAEGPSAS NT seq 255 nt NT seq  +upstreamnt  +downstreamnt gtgagcaacaacaaaggccaactcctgcaggacccgtttctgaaccagctccgtcgtgag cacgtgccggtgtcgatctacctcgtcaacggcatcaagctgcagggccagatcgagtcc ttcgatcagtatgtcgtgctgctgcgcaacaccgtcacccagatggtgtacaagcacgcc atttcgaccatcgtgccgggccgtccggtgcacttcacggtcgggcagccggccgagggt ccgtcggcatcgtga

DBGET integrated database retrieval system