KEGG   Triticum urartu (red wild einkorn wheat): 125553966
Entry
125553966         CDS       T08232                                 
Name
(RefSeq) indole-2-monooxygenase-like
  KO
K13223  indole-2-monooxygenase [EC:1.14.14.153]
Organism
tua  Triticum urartu (red wild einkorn wheat)
Pathway
tua00402  Benzoxazinoid biosynthesis
tua00999  Biosynthesis of various plant secondary metabolites
tua01100  Metabolic pathways
tua01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tua00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00402 Benzoxazinoid biosynthesis
    125553966
   00999 Biosynthesis of various plant secondary metabolites
    125553966
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:tua00199]
    125553966
Enzymes [BR:tua01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.153  indole-2-monooxygenase
     125553966
Cytochrome P450 [BR:tua00199]
 Cytochrome P450, plant type
  CYP71 family
   125553966
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 125553966
NCBI-ProteinID: XP_048573560
LinkDB
Position
4:476990866..476992767
AA seq 528 aa
MAHVHVDELLHEAAAAAPRSLLIASAVLFSLVVVPLLLRIISKQGAASDAKLLSLLPSPP
TKLPIIGHLHLMGDLPYVSLAGLAAKYGPELMLVHLGAVPTAVVSSPRTAEAVLRTHDHI
FASRPRSMVFDIIMYGQTDSCFAPYGEHFRKARKLVTVHMLNARKIRSQRPARVEEVRLV
IGKIAKAAAAREAVDMSELLHSYVNDLVCRAVSGKFSQEEGRNKLFRELTDINAALLGGF
NILDYFPSLGRFELVCKMACAKARRVRKRWDLLLDKLIDDHAARMVSREDEAQPAQEEDK
DFIDVSLSLQQEYGLTRDHIKAILIDMFEAGTDTSYMTLEFAMAELIRKPHLMKKLQEEV
RRNVPNGQEMVAEDDLPNMTYLKAVIKETLRLHPPVPLMIPHFSLDACTVDGYTIPANTR
VVINAWALGRHSSYWENENEFQPERFMNGAGVDLKPNEFHYLPFGFGRRMCPGVHSASAT
VEAMLANLMYRFDWKLPPGLKEEDIDMTEVFGITVSRKEKLILVPVTA
NT seq 1587 nt   +upstreamnt  +downstreamnt
atggctcacgtacatgtagacgagctgctccacgaagcagcagcggcagctccacgatct
ctcttgatcgcgagtgcggtgctcttctcccttgtggttgtgccgctcctactccgcatt
attagcaagcagggagcggcaagcgatgccaagctgctgagcctgctcccatctcccccg
acgaagctccccatcatcgggcacctgcacctaatgggcgatctcccctacgtctccctc
gccggcctggccgccaagtacggcccggaactcatgctggtacacctcggtgccgtgccc
accgccgtcgtgtcctcgccgcgcactgccgaggccgtcctgcgcacccacgaccacatc
ttcgcgtcacggccgcggtcgatggtcttcgacatcatcatgtacgggcagacggactcg
tgcttcgcgccctacggcgagcacttccggaaggccaggaagctggtgacggtgcacatg
ctcaacgccaggaagatacggtcccagcgcccggcccgggtggaggaggtccggctagtg
attggaaagatcgccaaggctgcggccgcgcgcgaggccgtggacatgagcgagctcctg
cactcgtacgtcaacgacctcgtttgccgtgctgtgtcgggcaagttctcccaggaggag
gggcggaacaagctgttccgtgagctcaccgacatcaacgcggcgctcctgggagggttc
aacatcctcgactacttcccgagcctggggaggttcgagttggtctgcaagatggcctgc
gccaaggcccgacgggtgaggaagcggtgggacctgctcctcgacaagctaattgacgac
catgcagcaaggatggtaagccgtgaggatgaggcccagccggcgcaagaggaagacaaa
gacttcatcgacgtatccctatctcttcagcaggagtatggtctcaccagggaccatatc
aaggccatcttgatagacatgtttgaggccggcacggacacctcgtatatgacgctggag
tttgccatggcggagctcatacggaagccacaccttatgaagaagctgcaggaagaggta
aggaggaatgtaccaaacgggcaagagatggtcgccgaagacgatctccccaacatgacc
tacctcaaggctgtcatcaaggagacactccggctgcacccgccggtacctctcatgatt
ccacacttctccctagacgcctgcaccgttgatggctacacgatcccagcaaacactcgt
gtcgttatcaacgcctgggcactcggcaggcacagtagctactgggaaaatgaaaatgaa
ttccaacctgagagatttatgaatggagccggcgttgatctgaagccaaatgagttccat
tacttgccatttgggtttggacgtagaatgtgccctggggttcactcggcatcagcaacg
gtcgaggcaatgctggcaaacctcatgtaccgtttcgattggaagcttccacccggattg
aaggaagaggacatagatatgactgaagtgtttggaataacagtttcaagaaaggaaaag
ctcatcttagtccccgtgaccgcatga

DBGET integrated database retrieval system