Tumebacillus avium: CBW65_16625 Help Entry CBW65_16625       CDS       T04874                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tum  Tumebacillus avium Pathway tum00998   Biosynthesis of various antibiotics tum01100   Metabolic pathways tum01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tum00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CBW65_16625    00074 Mycolic acid biosynthesis     CBW65_16625   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CBW65_16625 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Guanylate_cyc TMEM210 Motif Other DBs NCBI-ProteinID:  ARU62408 UniProt:  A0A1Y0IPB7 LinkDB All DBs Position 3424422..3424658 Genome browser AA seq 78 aa AA seqDB search MSADIFAKVKTIIVDRLGVEEDQVKLEASFKEDLGADSLDVVELVMELEDEFDMEISDED AEKINTVGDVVSYITSNK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtccgcagatatctttgcaaaagttaaaaccatcatcgtagaccgactgggtgttgaa gaagatcaagttaaacttgaggcctccttcaaagaagacctcggtgccgactctcttgat gttgttgagttggtgatggaactcgaagatgagttcgatatggaaatctctgatgaagac gcagagaagatcaacaccgtaggtgacgtagtatcctacatcacttcgaataagtaa

DBGET integrated database retrieval system