KEGG   Tupaia chinensis (Chinese tree shrew): 102473291
Entry
102473291         CDS       T02978                                 
Symbol
MRAP
Name
(RefSeq) melanocortin 2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04927  Cortisol synthesis and secretion
tup04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:tup00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    102473291 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102473291 (MRAP)
SSDB
Motif
Pfam: MRAP bCoV_NS7B
Other DBs
NCBI-GeneID: 102473291
NCBI-ProteinID: XP_006153926
LinkDB
Position
Un
AA seq 132 aa
MANRTNSSAAYYSYEYYLDYLDLIPVDEKRLKANKHLIVIAFWVSLAAFVVLLFLILLCI
SWSGSLQRRNSPQPHPTCPWSYGLLLCIRRHLERHRATRGDLQTPQSSVEEPGSRAGPKQ
QPQRESSSAMAP
NT seq 399 nt   +upstreamnt  +downstreamnt
atggccaataggaccaactcctccgcagcctactatagctacgaatactacctggactac
ctggacctcattcctgtggatgagaagaggctgaaagccaacaaacacctgatcgtcatt
gccttctgggtgagcctggctgccttcgtggtgctcctctttcttatcttactctgcatt
tcctggtcaggctccctgcagaggaggaatagtccccagccccacccaacatgcccatgg
agctacggccttctcctctgtattcgaaggcacctggagcgtcacagggccacccggggg
gacttgcagactccacagagctcagtggaggagccaggaagcagagctggccccaagcag
cagccacagcgggagagctcctctgccatggccccctaa

DBGET integrated database retrieval system