Tupaia chinensis (Chinese tree shrew): 102500815 Help Entry 102500815         CDS       T02978                                  Symbol GNRH2 Name (RefSeq) gonadotropin releasing hormone 2   KO K05252   gonadotropin-releasing hormone Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04080   Neuroactive ligand-receptor interaction tup04081   Hormone signaling tup04912   GnRH signaling pathway tup04929   GnRH secretion Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     102500815 (GNRH2)    04081 Hormone signaling     102500815 (GNRH2)  09150 Organismal Systems   09152 Endocrine system    04929 GnRH secretion     102500815 (GNRH2)    04912 GnRH signaling pathway     102500815 (GNRH2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tup04052]     102500815 (GNRH2) Cytokines and neuropeptides [BR:tup04052]  Neuropeptides   GPCR binding    102500815 (GNRH2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GnRH DUF1180 Motif Other DBs NCBI-GeneID:  102500815 NCBI-ProteinID:  XP_006164013 LinkDB All DBs Position Un AA seq 111 aa AA seqDB search MASSMLGFLLLLLLLMAAHPGPSEAQHWSHGWYPGGKRASNSPQDPQSALRPPAPSAAQT AHSFRSAALASPEDSVPWEGRTTAGWSLRRKQHLMRTLLSAAGAPRPAAVQ NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggccagttccatgctgggcttcctcctcctgctgctgctgctgatggctgcccaccct ggaccctcggaggcccagcattggtcccacggctggtaccctggaggaaagcgagcctcc aactcaccccaggaccctcaaagtgcccttaggcccccagcccccagcgcagcccagact gctcatagcttccgaagcgctgctctggcttcccccgaggacagtgtgccctgggagggc aggaccacagcaggatggtctctccgcaggaagcagcacctgatgcggacactgctgagc gcagccggagcgccgcgccccgccgccgtccaataa

DBGET integrated database retrieval system