Tupaia chinensis (Chinese tree shrew): 102501535 Help Entry 102501535         CDS       T02978                                  Symbol GNG12 Name (RefSeq) G protein subunit gamma 12   KO K04347   guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04010   MAPK signaling pathway tup04014   Ras signaling pathway tup04062   Chemokine signaling pathway tup04081   Hormone signaling tup04082   Neuroactive ligand signaling tup04151   PI3K-Akt signaling pathway tup04371   Apelin signaling pathway tup04713   Circadian entrainment tup04723   Retrograde endocannabinoid signaling tup04724   Glutamatergic synapse tup04725   Cholinergic synapse tup04726   Serotonergic synapse tup04727   GABAergic synapse tup04728   Dopaminergic synapse tup04810   Regulation of actin cytoskeleton tup04926   Relaxin signaling pathway tup05032   Morphine addiction tup05034   Alcoholism tup05163   Human cytomegalovirus infection tup05167   Kaposi sarcoma-associated herpesvirus infection tup05170   Human immunodeficiency virus 1 infection tup05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102501535 (GNG12)    04014 Ras signaling pathway     102501535 (GNG12)    04371 Apelin signaling pathway     102501535 (GNG12)    04151 PI3K-Akt signaling pathway     102501535 (GNG12)   09133 Signaling molecules and interaction    04082 Neuroactive ligand signaling     102501535 (GNG12)    04081 Hormone signaling     102501535 (GNG12)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102501535 (GNG12)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     102501535 (GNG12)   09152 Endocrine system    04926 Relaxin signaling pathway     102501535 (GNG12)   09156 Nervous system    04724 Glutamatergic synapse     102501535 (GNG12)    04727 GABAergic synapse     102501535 (GNG12)    04725 Cholinergic synapse     102501535 (GNG12)    04728 Dopaminergic synapse     102501535 (GNG12)    04726 Serotonergic synapse     102501535 (GNG12)    04723 Retrograde endocannabinoid signaling     102501535 (GNG12)   09159 Environmental adaptation    04713 Circadian entrainment     102501535 (GNG12)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102501535 (GNG12)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102501535 (GNG12)    05163 Human cytomegalovirus infection     102501535 (GNG12)    05167 Kaposi sarcoma-associated herpesvirus infection     102501535 (GNG12)   09165 Substance dependence    05032 Morphine addiction     102501535 (GNG12)    05034 Alcoholism     102501535 (GNG12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tup04147]     102501535 (GNG12)    04031 GTP-binding proteins [BR:tup04031]     102501535 (GNG12) Exosome [BR:tup04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    102501535 (GNG12)   Exosomal proteins of colorectal cancer cells    102501535 (GNG12) GTP-binding proteins [BR:tup04031]  Heterotrimeric G-proteins   Gamma Subunits    Gamma [OT]     102501535 (GNG12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-gamma CP12 Motif Other DBs NCBI-GeneID:  102501535 NCBI-ProteinID:  XP_006167215 LinkDB All DBs Position Un AA seq 72 aa AA seqDB search MSSKTASTNNIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTSE NPFKDKKTCIIL NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgtccagcaagacagcaagcaccaacaacatagcccaggcccgaaggactgtgcagcag ttaagattagaagcttccattgaaagaataaaggtttcaaaggcatcagcagacctcatg tcctactgcgaggagcacgccaggagtgatcctttgctgataggaataccgacttcagaa aaccctttcaaggataaaaaaacatgcatcatcttatag

DBGET integrated database retrieval system