KEGG   Thermoplasma volcanium: TVG1289977
Entry
TVG1289977        CDS       T00042                                 
Symbol
TVG1289977
Name
(GenBank) dihydrodipicolinate synthase
  KO
K18127  2-dehydro-3-deoxy-D-gluconate aldolase [EC:4.1.2.51]
Organism
tvo  Thermoplasma volcanium
Pathway
tvo00030  Pentose phosphate pathway
tvo00052  Galactose metabolism
tvo01100  Metabolic pathways
tvo01120  Microbial metabolism in diverse environments
tvo01200  Carbon metabolism
Module
tvo_M00309  Non-phosphorylative Entner-Doudoroff pathway, gluconate/galactonate => glycerate
Brite
KEGG Orthology (KO) [BR:tvo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TVG1289977 (TVG1289977)
   00052 Galactose metabolism
    TVG1289977 (TVG1289977)
Enzymes [BR:tvo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.51  2-dehydro-3-deoxy-D-gluconate aldolase
     TVG1289977 (TVG1289977)
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: BAB60394
UniProt: Q979B0
LinkDB
Position
complement(1289977..1290846)
AA seq 289 aa
MYNGIVTPMLTPFNRAGEIDYDATRLLIQDLKGYGVSGLFPMGSTGLFPMFSLEERKKFL
QFVSENRNNLTVYAGVGSSSTQESIELSKFTEDVGIEVRVLMPTYYIKPDEEWMYKHFSE
VISASSNDLFIYNIPQLAGSWVPENVIKKLKSEFSQVKGIKDSSGDMRFFSRIVTLVSKD
FSVFQGQDDLLLTSMALGANGGVCGLSNISGSIVDLYKAFQSGDLKKSREIQLNKVNPLM
YAVNAPTFPSGYYYAFYKKHNINGGYRSPMVQPSKEHSRVIDEATSQQI
NT seq 870 nt   +upstreamnt  +downstreamnt
atgtataatgggatcgttacacctatgcttactccctttaacagggcaggagaaatagat
tacgatgcaacaaggctcttaatacaggatttgaaaggttacggtgtatctgggctattt
ccgatgggttcaactggcctattccctatgttcagcttggaagagagaaagaagtttttg
cagtttgtgagcgaaaataggaacaatttgacagtatacgcgggtgttggttcatcaagc
acgcaagagtccatagaactgtctaagtttacagaggatgtgggaattgaggtaagggtg
ctaatgccaacttactacataaagccggacgaagagtggatgtacaagcatttctctgag
gtcatatccgcttcctctaacgacctatttatttataatatcccgcagcttgccggctca
tgggtacctgagaatgtcataaaaaaacttaaatctgagttttcgcaggtaaaggggata
aaagatagttctggtgatatgaggttcttctccaggatagtaactcttgtttcaaaggac
ttcagcgtatttcaagggcaggatgatcttctgcttacttctatggccttgggtgcaaac
ggcggagtatgcggtctctcaaatatttcaggaagtatagttgatctttacaaagccttc
caatctggggatctaaagaaatctagagaaatacaactgaacaaagttaaccctcttatg
tatgcggttaatgcgcctacgttcccttcggggtattattatgctttttataaaaagcat
aacataaacggtggatacagatcgcctatggttcaaccatcaaaggagcattccagggta
atagatgaggcaacatctcaacaaatataa

DBGET integrated database retrieval system