KEGG   Ursus arctos horribilis (North American brown bear): 113256840
Entry
113256840         CDS       T05909                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
uah  Ursus arctos horribilis (North American brown bear)
Pathway
uah04927  Cortisol synthesis and secretion
uah04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:uah00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    113256840 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    113256840 (MRAP)
SSDB
Motif
Pfam: MRAP ABC2_membrane_4 PspB
Other DBs
NCBI-GeneID: 113256840
NCBI-ProteinID: XP_026356561
UniProt: A0A3Q7V5N2
LinkDB
Position
Unknown
AA seq 79 aa
MANQTNASTPYDSYEDYLDYLDLIPVDERKLKANKYLIVITFWVSLAFFVMLLFLILLYM
SWSGSSQELASDDDPHRIS
NT seq 240 nt   +upstreamnt  +downstreamnt
atggccaaccagaccaacgcctccaccccgtacgacagctacgaggactacctggactac
ttggacctcattcccgtggatgagaggaagctgaaagccaacaaatatttgattgtcatc
accttctgggtgagcctggcattcttcgtcatgcttctcttcctcatcctgctctacatg
tcctggtcaggctcctcacaggaactggcctcggatgacgacccccaccgcatcagctga

DBGET integrated database retrieval system