Ursus arctos (brown bear): 113258277 Help Entry 113258277         CDS       T05909                                  Symbol GHRH Name (RefSeq) somatoliberin   KO K05260   growth hormone-releasing hormone Organism uah  Ursus arctos (brown bear) Pathway uah04080   Neuroactive ligand-receptor interaction uah04081   Hormone signaling uah04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:uah00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     113258277 (GHRH)    04081 Hormone signaling     113258277 (GHRH)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     113258277 (GHRH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uah04052]     113258277 (GHRH) Cytokines and neuropeptides [BR:uah04052]  Neuropeptides   GPCR binding    113258277 (GHRH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_2 Motif Other DBs NCBI-GeneID:  113258277 NCBI-ProteinID:  XP_026358707 LinkDB All DBs Position Unknown AA seq 124 aa AA seqDB search MLLWVFFLVMLTLSSGSHSFPPSLPLRIPRYADAIFTNSYRKVLGQLSARKLLQDIMSRP HGERNWEQGAKARLGRQVDGMGAGQKQTALESILAALLQKRRRGGLENCSHCPMSLGLNH ANKW NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgctgctctgggtgttcttcctggtcatgctcaccctcagcagtggctctcactctttc ccaccgtccctgcccctcagaatccctcggtatgcagacgccatcttcaccaacagctac cggaaggtgctgggccagctgtctgcccgcaagctactgcaggacatcatgagccgcccg cacggagagagaaactgggagcaaggagcaaaggcacggcttggccgtcaggtggacggt atgggggcaggccaaaagcagacggcattggagagcatcctggcagccctgctgcagaaa cgcagaagaggaggcttagagaactgcagccactgccccatgtccctcggcctcaaccac gccaacaagtggtga

DBGET integrated database retrieval system