KEGG   Candidatus Uabimicrobium amorphum: UABAM_00623
Entry
UABAM_00623       CDS       T07685                                 
Name
(GenBank) RedV protein
  KO
K21785  4-hydroxy-2,2'-bipyrrole-5-methanol dehydrogenase
Organism
uam  Candidatus Uabimicrobium amorphum
Pathway
uam00333  Prodigiosin biosynthesis
uam01100  Metabolic pathways
uam01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:uam00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    UABAM_00623
SSDB
Motif
Pfam: Nitroreductase TM1586_NiRdase
Other DBs
NCBI-ProteinID: BBM82280
UniProt: A0A5S9IJN2
LinkDB
Position
896323..897426
AA seq 367 aa
MKSLKNRLHNAIDLAATAPSSHNSQPWEIVLFDSREALSSLECFGINLSSSALYIAVCLN
KERQLRSLDCHHLEMALSIGIFLENLSLALHSQRCCATFCWANSQNVVIKGISSNWKPLA
IIAVSDSDHDFDTAFLDKRITNRGPYQQQRISSDVQQQLINSNSLLFNDAKEHCRICFVE
DSEKISRIANFVSTHAKLEFTHSKAWRETYKFVSFGAQKEIGLPITQLFGPLSTLKKYWY
RVLFSPFVMSFLKHTKFPETIAAQFGQLVATTPALLYVNFHEENPDTLTLLKGGALLFQL
WLNAAKEGISFHPMSIVLQHTDICKAFVKDHGLPRGRSMFFSRVGYPQFEFPPAPKRKNL
SREIHTI
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgaaatcattgaaaaatagattacacaacgctattgatcttgctgccacagcgccatct
tcacacaatagtcaaccatgggaaattgttttatttgacagtcgcgaagctctttcgtcc
cttgaatgtttcggaatcaatttgtcttcctcggcactttatattgccgtttgtttgaat
aaagaacgtcaactacgttctttagattgtcaccatctagaaatggcgttgagtattggt
atttttctagaaaacctaagtttggcattacattctcagaggtgctgtgccacgttttgc
tgggcaaattcacaaaatgttgttattaagggtatttcttcaaattggaaaccgttggcc
attattgccgtttctgatagcgatcacgactttgatacggcatttttggacaaacgtatc
accaatcgcggtccatatcagcaacaacgcatttcttccgatgtccagcaacaacttatc
aatagcaattctctgttgtttaacgatgccaaggagcattgtcgcatctgttttgtcgaa
gatagcgaaaaaatttcacgtatagcaaattttgtctctactcacgctaagttggaattc
acacatagtaaagcgtggcgcgaaacatataaattcgttagctttggtgcacaaaaagaa
ataggtctacccattacccaattatttgggccattgtccacgttgaaaaaatattggtac
cgcgtattgttttcaccttttgtaatgagttttttaaaacacacgaaatttccagagaca
atcgctgcacagtttggacaactcgtggcaacaacccccgctcttttgtatgtaaatttt
catgaagagaacccggatactcttaccctactcaaaggcggagcgctgttatttcaattg
tggttgaacgcagccaaagaagggattagttttcaccccatgagtattgttttgcaacac
actgatatttgcaaagcatttgttaaggaccacggtcttcctcgtgggcgttccatgttt
tttagtcgtgtaggatacccacaatttgaatttcctcccgcaccaaaaagaaaaaatcta
tcacgtgaaatacacactatataa

DBGET integrated database retrieval system