KEGG   Candidatus Uabimicrobium amorphum: UABAM_00628
Entry
UABAM_00628       CDS       T07685                                 
Name
(GenBank) phosphoenolpyruvate synthase
  KO
K21787  prodigiosin/undecylprodigiosin synthetase
Organism
uam  Candidatus Uabimicrobium amorphum
Pathway
uam00333  Prodigiosin biosynthesis
uam01100  Metabolic pathways
uam01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:uam00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    UABAM_00628
SSDB
Motif
Pfam: PPDK_N PEP-utilizers
Other DBs
NCBI-ProteinID: BBM82285
UniProt: A0A5S9IKJ4
LinkDB
Position
complement(902078..904723)
AA seq 881 aa
MTILNLQNITKKDQPIVGNKAFQLSCLLKEGFTVPSGFVITCDCYREFMKTTGIDTIIKE
YKYDSNTIQDFCQSIQHKISQEALPLSVTSEIKKHNDLLQNKAVAVRSSAINEDTQSLSF
AGQYQTILNVVGEEKISAAILKCWASLWSYRALSYRMKMHESYDPGEMAVIVQQMVPAQK
AGVVFTQNPITGNDQETLVESCWGLGEAVVSGKTATDSFVVSNDHITHKTIRYKLMMSSA
VENTMHTVKIPEDQRSLPSLSDTEALELAKIAKNIRDIYNSPQDIEWASANQKFYILQTR
PITAIEHQSFQQQQEDTKAVYTMVDIGESWTGMFSPLGMSFAKHYQYHTHGKLLRTLGLY
DTGEPQKYMLTLYGRPYVNASYWAWLYTQSAIFRDQSKFVCRYASAEMDLSNYKGPYGAG
PTGLKNLFTNLFYFGYQSRLMLVYKRRAKKAIARRLEVLDKFRAVDLTTLSLPQLHSAFK
EAYEYFHKSSELMGPPYFNSFIIYDIVSLLCDQWIDDSRGADIKQKIKAGASDLRTLEVS
FALADLATEAQKVAEVSDIILDKEPREIYPALCKIPSAEKFLNKVQAFLRAHGVRGQREM
DLATPRWLDDPSYAFYMMKTYIKEDHVGEVQKRRREREQVTKDVLKDLSWFKRKMLKFLI
NSYLKMSHWREATRMGYIQGIWMIRTLVHEVIRRLVSEEHVLKSEEQGIFIDYEDILDYV
AEKNSAKNIFTPEKIEKSHKNHINNQKIPAPPLTIIGSWHPAQQQVKSFSGKTITGLGTS
VGYIKGKARIILDLEQQIDEFTKGEILVTHFTDTAWTPLFNLATAVVTDIGSVLSHSSIV
ARELGIPAVVNTEIATQTIKTGDIITVDGNNGKVYLERNNA
NT seq 2646 nt   +upstreamnt  +downstreamnt
atgactattttaaacctacaaaatattaccaaaaaagatcaacctattgtgggcaacaaa
gcctttcaattgagttgtctattgaaagaaggtttcaccgttcccagtggattcgtcatt
acatgtgactgctatcgtgaatttatgaaaactacaggcattgacaccatcatcaaagag
tataaatacgatagtaacaccattcaagatttttgccaatccattcaacataagatttcc
caagaagccctaccactctcggtaacaagtgaaataaaaaaacataatgatttattgcaa
aacaaagccgtcgccgtaagatcatccgcaatcaatgaagacacccaaagcctatctttt
gctggtcaataccaaaccattttgaacgtggtgggtgaggaaaaaattagcgccgcaatt
cttaaatgctgggcgtcactgtggtcttatcgtgcacttagttaccgaatgaaaatgcac
gagtcttatgacccaggagaaatggcggttattgtacaacaaatggttccagcgcaaaaa
gccggtgttgttttcacacaaaaccccatcaccggaaacgaccaagagacacttgtcgaa
tcttgttggggattgggagaagccgttgtttctggcaaaaccgcaacagattcatttgtc
gtcagtaacgatcacattacacacaaaaccattcgctacaaactcatgatgtcttccgca
gtagaaaacactatgcacacggtaaaaatacctgaagaccaaagaagtttaccatctctg
agtgacacagaggctttggaactcgcaaaaattgccaaaaatatccgtgatatttacaac
tctcctcaggatatagaatgggcctctgccaatcaaaagttttacattttacaaactagg
ccgattaccgcaatagaacaccaaagttttcaacaacaacaagaagatactaaggccgta
tacacgatggttgacattggcgaatcgtggacgggaatgttttcgccactgggcatgtct
tttgccaaacactatcaatatcatacccacggaaaactattgcgaacacttggactttac
gacacaggggagccacaaaaatatatgttgacattgtacggacgcccctacgtcaacgca
tcgtattgggcatggctctatacacaatccgcaatatttcgtgaccaaagtaaatttgta
tgtcgttatgccagtgccgaaatggatttatccaactacaaaggcccatatggagcgggg
ccaacaggactcaaaaatttatttaccaatctgttttactttggttatcaatcgcggcta
atgcttgtgtataaacgtcgtgccaaaaaagccatcgctcgccgtttagaagtcctcgat
aagtttcgcgctgtagatttaaccaccctttctctaccacagctacacagcgcctttaaa
gaggcgtatgaatattttcacaaaagtagcgaattgatgggaccaccttacttcaacagt
tttatcatctacgacattgtttccctattatgcgatcaatggattgatgatagtcgcggg
gctgatatcaaacaaaaaataaaggctggagcctctgacttgcgcaccctagaagtttcg
tttgccctcgctgatttagcgacagaagcacaaaaagttgcagaggttagtgacattatt
ctcgacaaagagccgcgagaaatttatcccgccttgtgtaaaatcccttccgctgagaaa
tttttaaacaaagtacaagcgtttctacgtgcacatggcgtgcgtggtcaaagagaaatg
gatcttgcaactccgcgatggctagacgatcctagttatgcattttacatgatgaaaacc
tacatcaaggaagaccatgtgggcgaggttcaaaaaaggcgtcgtgaaagagaacaagtc
accaaagatgtactcaaagacttgtcgtggtttaaacgcaaaatgttgaaatttctcatc
aacagttatcttaaaatgagccactggcgcgaagcgacgcgtatgggttatatccaagga
atatggatgatacgcactctcgttcatgaggtaatacggcgtttggtgagcgaagagcat
gttctgaaaagtgaagaacaaggtatattcattgattacgaggatatattggactatgtc
gccgagaaaaattcagccaaaaacattttcacacccgaaaaaatagaaaaaagtcacaaa
aatcatatcaacaaccaaaaaataccagcaccgcccctaaccatcatcggcagttggcac
cctgcacaacaacaagtgaaaagttttagcggcaaaaccattaccggtcttggaacgagc
gtaggatacatcaaaggcaaagcaagaattattttagatttagagcaacaaatagacgaa
tttaccaaaggagaaatcttagtcacccattttacggacaccgcctggacacctcttttt
aacttggcaacggctgttgtcaccgatataggttctgtactttcgcatagctcgattgtt
gctcgtgagctaggtattccagcggttgtaaatacagaaattgcgacacaaaccatcaaa
acaggtgacatcataacggtagatggcaataacggaaaagtatatctcgagaggaacaac
gcatga

DBGET integrated database retrieval system