KEGG   Candidatus Uabimicrobium amorphum: UABAM_06308
Entry
UABAM_06308       CDS       T07685                                 
Name
(GenBank) hypothetical protein
  KO
K24307  5-N-acetyl-7-N-(D-alanyl)-legionaminic acid cytidylyltransferase
Organism
uam  Candidatus Uabimicrobium amorphum
Pathway
uam00541  O-Antigen nucleotide sugar biosynthesis
uam01100  Metabolic pathways
uam01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:uam00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    UABAM_06308
SSDB
Motif
Pfam: CTP_transf_3 IspD NTP_transf_3
Other DBs
NCBI-ProteinID: BBM87893
UniProt: A0A5S9ITK4
LinkDB
Position
complement(8848303..8849025)
AA seq 240 aa
MYNNKNILAIIPARAGSKRVPNKNIKDLAGKPLIGWTIEAATKSRYIDNVVVSTDSEKAI
EVAKSYDIEVPFVRPAHLATDAASSMDVITHALEFLQKASSSTYEYIMLLQPTSPLRDHM
DIDNAIEFCFEKNAEAVISVCEMEHSPLWSNTLPEDNSMENFISKEVSHKRSQELPTYYR
LNGAIYLAKTEKFLLDKTFFLEKNIFAYVMPNEKSVDIDNEIDMYLAQSLILSKKKQQES
NT seq 723 nt   +upstreamnt  +downstreamnt
atgtataacaacaaaaacattttggctattattcccgccagagcagggagtaaaagagtt
cccaataaaaatatcaaagacttggcaggtaaacccttgattggctggaccatagaagca
gcaacaaagtccagatacatagacaatgtggttgtttccacagatagcgaaaaagcgatt
gaggtggccaaatcatacgatatagaggttccttttgtccgccctgcacaccttgcaacc
gacgctgcgagtagcatggatgttattactcatgccttagagtttttacaaaaggcatct
tcctccacatatgaatatattatgctcttacaacctacttcgcctcttcgagaccatatg
gacattgacaatgccattgagttttgttttgagaaaaacgcagaggccgttatttctgtt
tgcgaaatggagcattctccactgtggagcaacaccttacccgaagacaacagtatggaa
aattttattagcaaagaagttagtcacaaaagaagccaagaactacctacttactatcga
ttgaatggagccatttatctagcgaaaacggagaagtttttgctagataaaaccttcttt
ctcgaaaagaacatttttgcgtacgtcatgccaaatgaaaagtctgtagatatagacaat
gaaatagacatgtatctagcgcaaagtttgattttatcgaaaaagaagcagcaagaatct
tag

DBGET integrated database retrieval system