Ursus americanus (American black bear): 123802321 Help Entry 123802321         CDS       T07931                                  Symbol CALML3 Name (RefSeq) calmodulin-like protein 3   KO K02183   calmodulin Organism uar  Ursus americanus (American black bear) Pathway uar04014   Ras signaling pathway uar04015   Rap1 signaling pathway uar04020   Calcium signaling pathway uar04022   cGMP-PKG signaling pathway uar04024   cAMP signaling pathway uar04070   Phosphatidylinositol signaling system uar04114   Oocyte meiosis uar04218   Cellular senescence uar04261   Adrenergic signaling in cardiomyocytes uar04270   Vascular smooth muscle contraction uar04371   Apelin signaling pathway uar04625   C-type lectin receptor signaling pathway uar04713   Circadian entrainment uar04720   Long-term potentiation uar04722   Neurotrophin signaling pathway uar04728   Dopaminergic synapse uar04740   Olfactory transduction uar04744   Phototransduction uar04750   Inflammatory mediator regulation of TRP channels uar04910   Insulin signaling pathway uar04912   GnRH signaling pathway uar04915   Estrogen signaling pathway uar04916   Melanogenesis uar04921   Oxytocin signaling pathway uar04922   Glucagon signaling pathway uar04924   Renin secretion uar04925   Aldosterone synthesis and secretion uar04970   Salivary secretion uar04971   Gastric acid secretion uar05010   Alzheimer disease uar05012   Parkinson disease uar05022   Pathways of neurodegeneration - multiple diseases uar05031   Amphetamine addiction uar05034   Alcoholism uar05133   Pertussis uar05152   Tuberculosis uar05163   Human cytomegalovirus infection uar05167   Kaposi sarcoma-associated herpesvirus infection uar05170   Human immunodeficiency virus 1 infection uar05200   Pathways in cancer uar05214   Glioma uar05417   Lipid and atherosclerosis uar05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     123802321 (CALML3)    04015 Rap1 signaling pathway     123802321 (CALML3)    04371 Apelin signaling pathway     123802321 (CALML3)    04020 Calcium signaling pathway     123802321 (CALML3)    04070 Phosphatidylinositol signaling system     123802321 (CALML3)    04024 cAMP signaling pathway     123802321 (CALML3)    04022 cGMP-PKG signaling pathway     123802321 (CALML3)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     123802321 (CALML3)    04218 Cellular senescence     123802321 (CALML3)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     123802321 (CALML3)   09152 Endocrine system    04910 Insulin signaling pathway     123802321 (CALML3)    04922 Glucagon signaling pathway     123802321 (CALML3)    04912 GnRH signaling pathway     123802321 (CALML3)    04915 Estrogen signaling pathway     123802321 (CALML3)    04921 Oxytocin signaling pathway     123802321 (CALML3)    04916 Melanogenesis     123802321 (CALML3)    04924 Renin secretion     123802321 (CALML3)    04925 Aldosterone synthesis and secretion     123802321 (CALML3)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     123802321 (CALML3)    04270 Vascular smooth muscle contraction     123802321 (CALML3)   09154 Digestive system    04970 Salivary secretion     123802321 (CALML3)    04971 Gastric acid secretion     123802321 (CALML3)   09156 Nervous system    04728 Dopaminergic synapse     123802321 (CALML3)    04720 Long-term potentiation     123802321 (CALML3)    04722 Neurotrophin signaling pathway     123802321 (CALML3)   09157 Sensory system    04744 Phototransduction     123802321 (CALML3)    04740 Olfactory transduction     123802321 (CALML3)    04750 Inflammatory mediator regulation of TRP channels     123802321 (CALML3)   09159 Environmental adaptation    04713 Circadian entrainment     123802321 (CALML3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123802321 (CALML3)   09162 Cancer: specific types    05214 Glioma     123802321 (CALML3)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     123802321 (CALML3)    05163 Human cytomegalovirus infection     123802321 (CALML3)    05167 Kaposi sarcoma-associated herpesvirus infection     123802321 (CALML3)   09171 Infectious disease: bacterial    05133 Pertussis     123802321 (CALML3)    05152 Tuberculosis     123802321 (CALML3)   09164 Neurodegenerative disease    05010 Alzheimer disease     123802321 (CALML3)    05012 Parkinson disease     123802321 (CALML3)    05022 Pathways of neurodegeneration - multiple diseases     123802321 (CALML3)   09165 Substance dependence    05031 Amphetamine addiction     123802321 (CALML3)    05034 Alcoholism     123802321 (CALML3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123802321 (CALML3)    05418 Fluid shear stress and atherosclerosis     123802321 (CALML3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:uar01009]     123802321 (CALML3)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:uar04131]     123802321 (CALML3)    03036 Chromosome and associated proteins [BR:uar03036]     123802321 (CALML3)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:uar04147]     123802321 (CALML3) Protein phosphatases and associated proteins [BR:uar01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      123802321 (CALML3) Membrane trafficking [BR:uar04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     123802321 (CALML3) Chromosome and associated proteins [BR:uar03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      123802321 (CALML3) Exosome [BR:uar04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    123802321 (CALML3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_FSTL1 SPARC_Ca_bdg UPF0154 EF_EFCAB10_C EH Dockerin_1 EF-hand_EFHB_C Temptin_C EF-hand_11 SAPC2_N Caleosin EF-hand_STIM1 EFhand_Ca_insen DUF5580_M SurA_N_3 Fe_hyd_lg_C Motif Other DBs NCBI-GeneID:  123802321 NCBI-ProteinID:  XP_045668900 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MADQLSEEQVAEFKEAFCLFDKDGDGVITTQELGTVMRSLGQNPTEAELRDMVGEIDRDG NGSVDFPEFLGMMARQLKGRDSEEQIREAFRVFDKDGNGLVSAAELRHVMTRLGEKLSDE EVDEMIRAADVDGDGQVNYEEFVHMLVSK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgaccagctgagcgaggaacaggtggccgagttcaaggaggccttctgcctgttt gacaaggacggggacggcgtcatcaccacccaggagctgggcaccgtcatgcgctccctg ggccagaaccccacggaggccgagctgcgtgacatggtgggcgagatcgaccgggacggc aacggctccgtggacttccccgagttcctgggcatgatggccaggcagctgaagggcagg gacagcgaggagcagatccgcgaggccttccgtgtcttcgacaaggacggcaatggcctg gtgagtgcggccgagctgcggcacgtgatgacccggctgggggagaagctgagtgacgag gaggtggacgagatgatccgggccgccgacgtggacggggatgggcaggtgaactacgag gagttcgtccacatgctggtatccaagtga

DBGET integrated database retrieval system