KEGG   Ustilago maydis: UMAG_03112
Entry
UMAG_03112        CDS       T01021                                 
Name
(RefSeq) hypothetical protein
  KO
K21820  unspecific peroxygenase [EC:1.11.2.1]
Organism
uma  Ustilago maydis
Brite
KEGG Orthology (KO) [BR:uma00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    UMAG_03112
Enzymes [BR:uma01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.1  unspecific peroxygenase
     UMAG_03112
SSDB
Motif
Pfam: Peroxidase_2
Other DBs
NCBI-GeneID: 23563673
NCBI-ProteinID: XP_011389463
UniProt: A0A0D1DZV2
LinkDB
Position
7:908444..909676
AA seq 410 aa
MKLSFNLPLLLSAAFMAAPALALPNLHAMMAPGPNGEPSHLEKRLLSANPLHLNNLFNDI
KNKVAELNSNVTVPDVGSLLNTKITDITPESIYNTFGIRRDLGLLPPAEDKYHPWQPPPK
GAKRGPCPGLNTIANHGYLPRSGVINPIDLIVGTFLGLNLSPDLAGILAAISFVGMGDLL
QMKLSIGGRYGLGGGLSHHGILEGDASVTRKDNYFGNSWDADPKLVKQFIQETNTYGKGN
VNIWSLANSRYRAWDYGRKNNPVFDFNPWRMLVAYGESGFVHEVLRGSFVKFDETMIKNW
FIDERFPKGWSKRIVPMTTPEILAWAGIVFVAKPTIPGWSIGKGAFIPLPTTDGAYQELK
SLLDPKTTGATLESLLCDASNAVLGFFPSQITNLLGVIGIKGVGAQFKCK
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgaagttgtccttcaacctgccgctgctgctctcggctgcctttatggcagcgcctgcg
ctggctctgccaaacctccacgccatgatggctcctggacccaacggcgagccttcgcac
cttgaaaagcgtctcctctcggctaacccgctgcacctgaacaacctgttcaacgacatc
aagaacaaggttgccgagctgaacagcaacgtcaccgttcctgacgtgggcagcctgctc
aacaccaagattactgatatcacgcccgaaagcatctacaacacctttggcattcgacga
gaccttggactcttgccgcccgccgaagacaagtaccacccgtggcagcctcctcccaag
ggtgccaagcgtggaccttgccctggtctcaacacaatcgccaaccacggctaccttcct
cgcagcggtgtgattaacccgatcgatctgatcgtcggtacgttcctcggcctcaacctc
agcccagaccttgctggtatcctggctgctatctcgtttgtcggcatgggtgacctgctg
cagatgaaattgtccatcggcggccgatacggacttggcggcggcttgagccaccacggt
atcctcgaaggcgatgcttcagtgacgcgtaaagataactactttggcaacagctgggac
gctgacccgaagctagtcaagcagttcatccaggagaccaacacttacggcaaaggaaac
gtcaacatttggtcgctcgccaactcgcgctaccgtgcttgggattatggccgcaagaac
aacccggttttcgacttcaacccctggcgaatgctcgtcgcatacggcgagagtggtttc
gtgcacgaggttctgcgtggctcttttgtcaagttcgacgagaccatgatcaagaactgg
ttcattgatgagaggttccccaagggctggtccaagaggattgtgcccatgacgactccc
gagattcttgcttgggccggtattgtgtttgtggccaagccgacgattcctggttggagc
atcggcaagggcgctttcatccccctgcccaccactgatggcgcttaccaggagctcaag
tcgctcctcgaccccaaaaccaccggtgccacgctcgagtcgctgctctgcgatgctagc
aatgctgtccttggctttttcccctcgcagatcaccaacctgcttggcgttattggcatc
aagggtgttggcgcccaattcaagtgcaaataa

DBGET integrated database retrieval system