Ursus maritimus (polar bear): 103669493 Help Entry 103669493         CDS       T03271                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism umr  Ursus maritimus (polar bear) Pathway umr04137   Mitophagy - animal umr04140   Autophagy - animal umr04144   Endocytosis umr04145   Phagosome umr04148   Efferocytosis umr05132   Salmonella infection umr05146   Amoebiasis umr05152   Tuberculosis Brite KEGG Orthology (KO) [BR:umr00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103669493 (RAB7A)    04145 Phagosome     103669493 (RAB7A)    04140 Autophagy - animal     103669493 (RAB7A)    04137 Mitophagy - animal     103669493 (RAB7A)    04148 Efferocytosis     103669493 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103669493 (RAB7A)    05152 Tuberculosis     103669493 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     103669493 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:umr04131]     103669493 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:umr04147]     103669493 (RAB7A)    04031 GTP-binding proteins [BR:umr04031]     103669493 (RAB7A) Membrane trafficking [BR:umr04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     103669493 (RAB7A) Exosome [BR:umr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103669493 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    103669493 (RAB7A)   Exosomal proteins of colorectal cancer cells    103669493 (RAB7A)   Exosomal proteins of bladder cancer cells    103669493 (RAB7A) GTP-binding proteins [BR:umr04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     103669493 (RAB7A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_7 NTPase_1 AAA_24 AAA_22 AAA_16 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 SRPRB ATP-synt_ab FLYWCH_N Motif Other DBs NCBI-GeneID:  103669493 NCBI-ProteinID:  XP_008696038 UniProt:  A0A384CNI7 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctctaggaagaaagtgttgctgaaggttatcatcctgggagattctggagttggt aagacatcactcatgaaccagtatgtgaacaagaaattcagtaatcagtacaaagctaca ataggagcagactttctgacaaaggaggtgatggtggatgacagactagtcacaatgcag atctgggacacggcaggccaggagcggttccagtccctcggcgtggccttctacagaggc gcagactgctgcgttctggtctttgacgttactgcccccaacacgttcaaaaccctcgat agttggagagatgagtttctcatccaggccagtccccgggatcctgaaaacttccccttc gttgtgttgggaaacaagattgacctcgaaaacagacaagtggccacaaagcgggcacag gcctggtgctacagcaaaaacaacattccctacttcgagaccagtgccaaggaggccatc aacgtggagcaggcgttccagacaattgcacggaatgcacttaaacaggaaacagaggtg gagctgtacaacgaattccccgaacccatcaaactggacaagaacgaccgggccaaggcc tcggcggagagctgcagttgctga

DBGET integrated database retrieval system