KEGG   Ursus maritimus (polar bear): 103670923
Entry
103670923         CDS       T03271                                 
Symbol
RIMKLA
Name
(RefSeq) ribosomal modification protein rimK like family member A
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00250  Alanine, aspartate and glutamate metabolism
umr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103670923 (RIMKLA)
Enzymes [BR:umr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     103670923 (RIMKLA)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     103670923 (RIMKLA)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 Dala_Dala_lig_C ATP-grasp CPSase_L_D2 Synapsin_C TTL
Other DBs
NCBI-GeneID: 103670923
NCBI-ProteinID: XP_008697660
UniProt: A0A384CT62
LinkDB
Position
Un
AA seq 433 aa
MAKRTGMNGAGEDAHGKNAGAVNEGRGGAGCADVLLACPSPQPGAGRRPVSLLQDFRCHF
QGCLLLGSVLRSRLEPVLLVGLDWGQHRAHSCPSIAGLQLNQKALTTFPDVVLVRVPTPS
VQSDSDITVLRHLEKLGCRLVNRPQSILNCVNKFWTFQELAGHGVPMPDTFSYGGHEDFS
KMIDEAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLIRHDVPYLFQKYVKESHGK
DIRVVVVGGRVIGSMLRCSTDGRMQSNCSLGGVGVMCPLTEQGKQLAIQVSNILGMDFCG
IDLLIMDDGSFVVCEANANVGFLAFDQACNLDVGGIIADYTMSLLPNRQTGKMAVLPGLS
SPREKKEPDGCASAQGVAESVYAINNGSTSSESEPELGEIRDSSVSTMGGPPPMLPEPGY
NINNRIASELKLK
NT seq 1302 nt   +upstreamnt  +downstreamnt
atggcaaagagaacagggatgaacggggcaggcgaagatgcccacggcaagaatgctgga
gccgtgaacgagggcagaggaggggctggttgtgcagatgtgctcctggcctgtcccagc
cctcagcccggagctggacgccggcccgtctcgttactacaggatttccggtgccatttt
caaggctgtcttctgctgggttcagtcttgaggagtcggctggagccagttcttctggtg
ggactagactggggccagcacagagctcactcctgtccttcaattgcaggccttcagctg
aaccagaaggcactcaccaccttcccagatgtggtgctcgtgcgggtgcccaccccctcc
gtgcagtcggacagcgacatcacggtcctgcgccacctggagaagctgggctgccgcctc
gtcaaccgcccccagagcattttaaactgcgtcaacaagttctggactttccaggagctg
gctggacatggggttcccatgccagacaccttctcctacggtgggcacgaagacttttcc
aagatgattgatgaggctgagcccctgggctacccggtcgtggtgaagagcacacgggga
caccggggaaaagctgtttttcttgcaagagataagcatcacctctcagacatctgccat
ctgatccgccatgatgtgccctacctgttccagaagtatgtgaaggagtcacacggcaaa
gatatccgggtggtggtggtcgggggccgggtgataggctctatgcttcgctgctccacg
gacggccggatgcagagcaactgctctctcggtggtgtgggcgtcatgtgcccgctgaca
gaacaaggcaaacagttggctatccaggtgtccaacatcctgggcatggacttctgtggc
attgatctcctcatcatggacgacggctccttcgtggtgtgtgaggcaaacgccaacgtc
ggcttcctagccttcgaccaggcgtgcaatttagatgtgggtggcatcatcgcggactac
accatgtccttgctgcccaataggcagactggcaagatggctgtcctcccaggactgtcc
agtcccagggagaagaaagagccagatggctgcgcttcagctcagggagttgcagagagc
gtctacgccatcaacaatgggtctacctctagtgagagtgagcctgaactgggagagatc
cgggattcctcagtgagcacgatggggggcccgccccccatgctgccagaacccggctac
aacattaacaacaggattgcttcagaattaaaacttaagtga

DBGET integrated database retrieval system