KEGG   Ursus maritimus (polar bear): 103678035
Entry
103678035         CDS       T03271                                 
Symbol
RAB6A
Name
(RefSeq) RAB6A, member RAS oncogene family
  KO
K07895  Ras-related protein Rab-6C
Organism
umr  Ursus maritimus (polar bear)
Brite
KEGG Orthology (KO) [BR:umr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103678035 (RAB6A)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:umr04031]
    103678035 (RAB6A)
Membrane trafficking [BR:umr04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab GTPases
    103678035 (RAB6A)
GTP-binding proteins [BR:umr04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab6/41 [OT]
    103678035 (RAB6A)
SSDB
Motif
Pfam: Ras Roc Arf SRPRB GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Gtr1_RagA CPT TetR_C_16
Other DBs
NCBI-GeneID: 103678035
NCBI-ProteinID: XP_008705544
UniProt: A0A384DFD5
LinkDB
Position
Un
AA seq 261 aa
MSAGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDR
TIRLQLWDTAGQERFRSLIPSYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVI
IMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQVIITFLFSTALLPGM
ESTQDRSREDMIDIKLEKPQEQPVSEGGCSCXSPLASLTFLQKLTALPPYTFIDCSVNIG
LNLFPSVITYCNSSLLPVSWR
NT seq 786 nt   +upstreamnt  +downstreamnt
atgtccgcgggcggagacttcgggaatccgctgaggaaattcaagctggtgttcctgggg
gagcagagcgttggaaagacatccttgatcaccagattcatgtatgacagttttgacaac
acctatcaggcaactattggtattgactttttatcaaaaacaatgtacttggaggatcga
acaatcaggctgcagctgtgggatactgcgggtcaggaacgtttccgtagcctcattccc
agttacatccgtgattctgctgcagccgtagtagtttacgatatcacaaatgttaactca
ttccagcaaactacaaaatggattgatgatgtcagaacagaaagaggaagtgatgttatc
atcatgctagtagggaataaaacagatcttgctgacaagaggcaagtatcaattgaggaa
ggagaaaggaaagccaaagagctgaatgttatgtttattgaaacaagtgcaaaagcagga
tacaatgtaaaacaggtaattatcacatttcttttttccacagctcttttgcctggaatg
gaaagcacacaggacagaagcagagaagacatgattgatataaaactggaaaagcctcag
gagcaaccagtcagtgaaggaggctgctcctgctaatcccccctggcatctttaactttt
ctccagaagctcactgctttgcccccttacactttcattgactgcagtgtgaatattggc
ttgaaccttttcccttcagtaataacgtattgcaattcatcattgctgcctgtctcgtgg
agatga

DBGET integrated database retrieval system