Vibrio cholerae O1 2010EL-1786: Vch1786_I2649 Help Entry Vch1786_I2649     CDS       T01650                                  Symbol hfq Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism vce  Vibrio cholerae O1 2010EL-1786 Pathway vce02024   Quorum sensing vce03018   RNA degradation vce05111   Biofilm formation - Vibrio cholerae Brite KEGG Orthology (KO) [BR:vce00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     Vch1786_I2649 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     Vch1786_I2649 (hfq)    05111 Biofilm formation - Vibrio cholerae     Vch1786_I2649 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:vce03019]     Vch1786_I2649 (hfq)    03036 Chromosome and associated proteins [BR:vce03036]     Vch1786_I2649 (hfq) Messenger RNA biogenesis [BR:vce03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      Vch1786_I2649 (hfq) Chromosome and associated proteins [BR:vce03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     Vch1786_I2649 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AET28194 LinkDB All DBs Position 1:2794158..2794421 Genome browser AA seq 87 aa AA seqDB search MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAIS TVVPARPVSHHSGDRPASDRPAEKSEE NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctctacaagacccatttctgaatgcactacgtcgtgaacgtatc cctgtttctatctaccttgtgaacggcattaaactgcaaggtcagatcgaatcatttgat caatttgtgatcttgctgaagaacacagtaaaccaaatggtttacaagcatgcgatttct actgtggttcctgctcgtccagttagccaccacagcggcgaccgcccagcatcggatcgt ccagcagagaagtctgaagagtaa

DBGET integrated database retrieval system