KEGG   Vibrio cholerae O1 MJ-1236: VCD_001949
Entry
VCD_001949        CDS       T00903                                 

Name
(GenBank) phospho-N-acetylmuramoyl-pentapeptide-transferase
  KO
K01000  phospho-N-acetylmuramoyl-pentapeptide-transferase [EC:2.7.8.13]
Organism
vcj  Vibrio cholerae O1 MJ-1236
Pathway
vcj00550  Peptidoglycan biosynthesis
vcj01100  Metabolic pathways
vcj01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VCD_001949
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    VCD_001949
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vcj01011]
    VCD_001949
Enzymes [BR:vcj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.13  phospho-N-acetylmuramoyl-pentapeptide-transferase
     VCD_001949
Peptidoglycan biosynthesis and degradation proteins [BR:vcj01011]
 Precursor biosynthesis
  Glycosyltransferase
   VCD_001949
SSDB
Motif
Pfam: Glycos_transf_4 MraY_sig1
Other DBs
NCBI-ProteinID: ACQ60118
LinkDB
Position
1:1020009..1021091
AA seq 360 aa
MIIWLAELLQPYFSFFRLFEYLSFRAIVSILTALGISLWMGPRMIKRLQMLQIGQVVRNE
GPESHFSKRGTPTMGGVMILAAITITVLLWADLTNPYVWAVLAVLLGYGAVGFVDDYRKV
VRKNTDGLIARWKYFWQSAIALVVAFALYAHGQDTAATQLVVPFFKDVMPQLGLMYIVLT
YFVIVGTSNAVNLTDGLDGLAIMPTVLVAAGFAAIAWATGNVNFANYLHIPYIPHSSELV
VVCTAMVGAGLGFLWFNTYPAQVFMGDVGALALGGALGTIAVLVRQEFVLVIMGGVFVME
TLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIVLVLIGLATLKVR
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgattatttggcttgctgaactgctccagccatatttttcgtttttccgtctgttcgaa
tatctctcatttcgcgccattgtcagcattctgactgcgcttgggatctcgttgtggatg
gggccgcgcatgattaagcgcctacaaatgctgcagattgggcaagtagtgcgtaatgaa
gggcctgaatctcacttcagtaaacgcggtactccgaccatgggtggggtgatgatcctt
gccgcgatcaccatcactgtactgctgtgggccgatctgactaacccttatgtttgggct
gtgcttgcggtactgctcggttacggtgcggtcggttttgtcgatgattaccgtaaagtg
gtgcgcaaaaataccgatggcttgatcgcgcgctggaaatacttctggcaatctgcgatt
gctttagtggttgcgtttgctctgtatgcgcacggccaagatacggcggcaacgcagttg
gtggtccctttctttaaagatgtgatgccacagctgggcttgatgtacattgtgctgacc
tatttcgtgattgttggtaccagtaatgcggtgaacttgaccgatggtctggatggcttg
gcgatcatgccaaccgtattggttgcagccggatttgcggcgattgcatgggcgaccggt
aacgttaacttcgcgaactatctgcatatcccttatattcctcactcttctgagttggtg
gtggtgtgtaccgcgatggttggtgcaggtttaggctttttatggtttaacacctatcca
gcccaagtatttatgggcgatgtcggcgcgttggcgttaggtggcgcgttaggtacgatt
gcggtactggttcgccaagagtttgtgttggtgatcatgggcggtgtattcgtgatggaa
accctgtcagtgattttgcaagttggttcttacaagctgcgtggacaacgtatcttccgt
atggcaccgattcaccatcactacgaattaaaaggctggccagaaccacgtgtgatcgtg
cgtttttggatcatctctatcgttttagtattgattggcttagcgacactcaaagttcgt
taa

DBGET integrated database retrieval system