KEGG   Vibrio cholerae O1 2012EL-2176: EN18_01085
Entry
EN18_01085        CDS       T03389                                 
Name
(GenBank) preprotein translocase subunit TatA
  KO
K03116  sec-independent protein translocase protein TatA
Organism
vcq  Vibrio cholerae O1 2012EL-2176
Pathway
vcq03060  Protein export
vcq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vcq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    EN18_01085
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EN18_01085
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcq02044]
    EN18_01085
Secretion system [BR:vcq02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein
   EN18_01085
SSDB
Motif
Pfam: TatA_B_E
Other DBs
NCBI-ProteinID: AIT31414
UniProt: A0A0H7G7B8
LinkDB
Position
2:173147..173383
AA seq 78 aa
MGGISVGKLLILGCIVALVFGTKKLRTIGEDAGYAIRSFQKALRGDEVTTQSSTAEESVD
SFAIEQESSHSSDSQRHS
NT seq 237 nt   +upstreamnt  +downstreamnt
atgggtggaatcagtgtgggtaagctcttaatcttggggtgtattgttgcgctggttttc
ggcactaagaaattgcgaaccataggtgaagatgcgggttatgcgattcgctcttttcaa
aaagcgttacgcggtgacgaagtgacgactcagtcatcaacggccgaggaatccgtcgac
agcttcgctattgagcaagagtcgtcccattcttctgattctcagcgccactcataa

KEGG   Vibrio cholerae O1 2012EL-2176: EN18_17105
Entry
EN18_17105        CDS       T03389                                 
Symbol
tatA
Name
(GenBank) preprotein translocase subunit SecA
  KO
K03116  sec-independent protein translocase protein TatA
Organism
vcq  Vibrio cholerae O1 2012EL-2176
Pathway
vcq03060  Protein export
vcq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vcq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    EN18_17105 (tatA)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EN18_17105 (tatA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcq02044]
    EN18_17105 (tatA)
Secretion system [BR:vcq02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein
   EN18_17105 (tatA)
SSDB
Motif
Pfam: TatA_B_E DUF4834
Other DBs
NCBI-ProteinID: AIT30731
UniProt: A0A2V4NJV4
LinkDB
Position
1:complement(2469585..2469833)
AA seq 82 aa
MGGISIWQLLIIAVIVVLLFGTKKLRGIGSDLGSAVKGFKKAMSEEESNSAANQKDADFE
TKNLEQAKTNASAEVKKDKEQA
NT seq 249 nt   +upstreamnt  +downstreamnt
atgggtggtatcagtatttggcaacttcttatcattgcagtgatcgtggtattgctgttt
ggcactaagaaactgcgtggtattggcagtgatttgggcagcgcggtcaaaggctttaag
aaagccatgtcggaagaagagtcaaacagcgcagcaaatcagaaagatgctgacttcgaa
accaaaaatcttgagcaggccaaaaccaatgcgtctgctgaagtgaaaaaagacaaagag
caggcataa

DBGET integrated database retrieval system