KEGG   Vibrio cholerae O1 2012EL-2176: EN18_01830
Entry
EN18_01830        CDS       T03389                                 
Name
(GenBank) preprotein translocase subunit SecF
  KO
K03074  preprotein translocase subunit SecF
Organism
vcq  Vibrio cholerae O1 2012EL-2176
Pathway
vcq03060  Protein export
vcq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vcq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    EN18_01830
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EN18_01830
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcq02044]
    EN18_01830
Secretion system [BR:vcq02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   EN18_01830
SSDB
Motif
Pfam: SecD_SecF Sec_GG DUF6097
Other DBs
NCBI-ProteinID: AIT31555
UniProt: A0A085QBE6
LinkDB
Position
2:complement(332512..333414)
AA seq 300 aa
MVDYLKSRIRPIRYITGIISVLLMVISLGAFAIKGLNMGLDFTGGMVTEAIINHSVTKSQ
LMDQLQPVLGESVSATPSGEEGRWVIRYPLAAEDATPVDIATELHHISDQVQIVSNSMVG
SQVGQELIDQGGLALLICLLSILAYLSFRFEWRLASGALLALLHDVILVLGFFAITQMEF
NLTVFAAVLAVLGYSLNDSIIISDRIRELLLAKQQTPTADINDQAIIATFSRTMVTSGTT
LMTISALWLMGGAPLQGFAIAMFIGIISGTWSSISIGTVLPEWLGLESKHYLPVELDAAP
NT seq 903 nt   +upstreamnt  +downstreamnt
atggttgactatttaaaatctcgaatccgtccgattcgctacatcactggcattatttcg
gtcttgttgatggtgatctcgctaggggcttttgcaatcaaaggcttgaatatgggctta
gatttcaccggcgggatggtcacggaagcgatcattaatcactcggtgaccaagtctcag
ctgatggatcaattacagccggtactgggggagtcggtttctgccacgccttcgggagaa
gaagggcgttgggtgatccgttatccattagctgctgaagatgctacgcctgtagacatt
gcgacagagctgcatcacatctcagaccaagtgcaaattgtcagtaacagcatggtggga
tcgcaagttgggcaagagttgatcgatcaaggcggactcgctttgttgatttgtctgctc
tcaatactggcttacttgagctttcgttttgaatggcgtttagcgagcggagccctatta
gccctactgcacgacgtgatcttggtactgggtttctttgcgataacgcaaatggaattc
aacttgacggtatttgctgcagtcttagcggtgctcggctattcattgaacgactcgatc
attatttcggatcgtatccgagaattactgttagcgaagcagcagacgccaaccgcagat
attaatgaccaagccattattgcgaccttctcacgtacaatggtgacatcaggtaccact
ttgatgaccatttcggcactttggctgatgggcggtgccccgttacaaggtttcgccatc
gccatgtttatcggcataatttcagggacttggtcatcgatttcgattggtactgtgtta
cctgaatggttaggtttggaatcgaagcactatctccctgttgagttggatgcagcacca
taa

KEGG   Vibrio cholerae O1 2012EL-2176: EN18_01835
Entry
EN18_01835        CDS       T03389                                 
Symbol
secD
Name
(GenBank) preprotein translocase subunit SecD
  KO
K03072  preprotein translocase subunit SecD
Organism
vcq  Vibrio cholerae O1 2012EL-2176
Pathway
vcq03060  Protein export
vcq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vcq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    EN18_01835 (secD)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EN18_01835 (secD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcq02044]
    EN18_01835 (secD)
Secretion system [BR:vcq02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   EN18_01835 (secD)
SSDB
Motif
Pfam: SecD-TM1 SecD_SecF MMPL Sec_GG eIF-1a Cas_Csy2
Other DBs
NCBI-ProteinID: AIT31556
UniProt: A0A0H6RXD5
LinkDB
Position
2:complement(333418..335256)
AA seq 612 aa
MKKKTQNQAAKRLINHYSAWKYVVLVTTIIILTLSAIPTWYGEQPSIQLQSKDATSVLRN
VPELTQLLNKQNIQADEITQQGDNTTLVFANETQQSQARNALDALVKEGDTITYSYVSVA
PKWLGNLGFSPIKLGLDLRGGVQFLLNVDVDKAFQEQRDSMMDAVKDSLRAERLRGVVVQ
AMGNDAFEVKTEQPQALSHVRKYLQENYRGWEIRQGSDQLQVQPSQQNKSEFQTATIQQN
LKIMRDRIEELGITEALVQRQGEHAIRIELPGVQDPSQAKNVIGATASLAFYEAKSPTDA
RSYDDLILEDGNGRPVILAKRPVLSGEHIVNARAGVDNMGMSEVNISLDHAGGKIMSDFS
GKHIGKPMATVYREYKTNARGETVRSEKVISVATIQSQLGSQFRITGAGSMEEAQQLALL
LRAGSLTAPVTIVEERTIGASLGEENIANGFAALALGMAMTLTFMALWYRRLGWVANVAL
LVNMACLLGLIALLPGAVLTLPGIAGLVLTVGMAVDTNVLIFERIRDKLSEGRNFAQAID
TGFDSAFSTILDANITTMITAVILYSIGNGPIQGFALTLGLGLLTSMFSGVFASRALINL
VWGRDTRRDVRV
NT seq 1839 nt   +upstreamnt  +downstreamnt
atgaagaaaaaaacacaaaatcaggcggcgaaacgcctgatcaaccactattccgcttgg
aagtatgtggttctggtaaccaccatcatcattctaaccttaagtgctattcctacttgg
tatggcgaacaaccttctattcagttgcaatctaaagatgcaacgagtgtattacgcaac
gttcctgagctgacgcaattgctcaataagcaaaatattcaggccgatgaaattacccaa
caaggggataacaccaccttggtttttgccaacgaaacgcagcaatcacaagccagaaat
gcactggatgcgcttgtgaaagaaggggatacgatcacgtattcttatgtgtctgttgcg
ccaaagtggctaggcaatttgggtttttcacccatcaaattaggcttggatttacgcggg
ggcgtacagtttctgctgaatgtggatgtcgataaggcctttcaagaacagcgcgacagt
atgatggatgcagtaaaagattcgctgcgtgcagagcgtttgcgcggtgttgtggtgcaa
gcgatgggtaatgatgcttttgaggtcaaaactgaacagccgcaagccttgagccatgta
cgcaaatacttgcaagaaaattatcgaggctgggagattcgtcaaggctcagatcagttg
caagttcagccatcacaacaaaataaatcagagtttcaaactgcgacgattcaacagaac
ttgaaaatcatgcgagatcggattgaagaacttgggattacagaagctctggttcaacgc
caaggtgaacatgcgatccgtatcgagctgcccggtgtgcaagacccctcacaggcgaag
aatgtgattggtgcgaccgcaagtttagcgttttatgaagcaaaatctccaacggatgcg
cgcagttacgacgatttaatcctagaagatggcaatggacgtcctgtgattctggctaag
cgtccagtgctgagtggcgagcatatcgtcaatgcccgtgcgggtgtggacaacatgggt
atgtctgaggtgaacatttcactggatcacgcaggcggcaaaatcatgagtgatttttcc
ggtaaacacattggcaaaccgatggcgaccgtctatcgcgaatataaaaccaatgcgcgt
ggcgaaaccgttcgcagtgagaaagtgatcagcgttgccaccattcaatctcagttgggg
agccaatttcgtattacgggcgcaggttcaatggaagaagcacagcagctcgccctactg
ttgcgtgcaggctcgctgacggcacctgtcaccattgttgaagagcgcaccatcggtgct
tctttgggtgaagaaaatattgccaacggttttgctgctttggcgcttggtatggcaatg
acgctgactttcatggcgctttggtatcgccgcttgggttgggtggcaaatgtcgctttg
ttggtcaacatggcttgtttgttgggtctgattgctttattgccaggggcagtattgacc
ctaccaggtattgcaggtttggtgttaaccgtgggtatggcggtggatactaacgtgctg
atctttgaacgtattcgcgacaaactcagtgaagggcgtaacttcgcacaagccattgat
accgggtttgacagtgctttcagcacgattttagacgccaacatcaccaccatgatcacg
gcagttattctgtattctatcggtaatggtcctatccaaggctttgctttgactttgggt
ttaggcctactcaccagtatgttcagtggcgtattcgcttcacgagcattgattaatttg
gtttggggacgcgatacgcgtcgtgatgtgagggtataa

KEGG   Vibrio cholerae O1 2012EL-2176: EN18_07100
Entry
EN18_07100        CDS       T03389                                 
Symbol
secD
Name
(GenBank) preprotein translocase subunit SecD
  KO
K03072  preprotein translocase subunit SecD
Organism
vcq  Vibrio cholerae O1 2012EL-2176
Pathway
vcq03060  Protein export
vcq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vcq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    EN18_07100 (secD)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EN18_07100 (secD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcq02044]
    EN18_07100 (secD)
Secretion system [BR:vcq02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   EN18_07100 (secD)
SSDB
Motif
Pfam: SecD-TM1 SecD_SecF MMPL Sec_GG FxsA Carot_N DUF6795
Other DBs
NCBI-ProteinID: AIT28816
LinkDB
Position
1:268293..270113
AA seq 606 aa
MVMLTIAVAALYALPNIYGEDPAIQITGARGASVDMSTLDAVTDALNKAQLSQKSIALEN
GSILVRFNDTDTQISARDIISEALGKDKIVALNLAPSTPYWLESIGAAPMKLGLDLRGGV
HFLMEVDMDAAMEKLVSQQEEAFRSDLRDEKIRYRAIRPLSDAVEVTLRDAEQLAQTKLL
LESKHRDMTFTTSESDGRFVLVAKFTEARLQEIRNYAVEQNITILRNRVNELGVAEPLVQ
RQGATRIVVELPGVQDTARAKEILGATATLEFREVDDKADLAAAAAGRAPAGSEIKFDRN
GRPVVLKKRVILGGSSITDASSSADEYGRPQVNISLDSEGGNKMSAFSKKNIGKLMATVF
AEYKDSGKRSPEGKVILTKHEEVINQATIQSALGRNFRITGIDSPAEAHNLALLLRAGAL
IAPISIVEERTIGPSMGQQNIDMGIQACIWGMVAVMLFTVLYYRKFGMIANIALMANLVL
IIGVMSMIPGATMTLPGIAGIVLTVGMAVDANVLIFERIREELREGKNPQQAIHQGYANA
FSTIADANITTLITAIILFAVGTGAIKGFAVTLSIGILTSMFTAIVGTRCIVNLLYGGKR
INKLSI
NT seq 1821 nt   +upstreamnt  +downstreamnt
atggtgatgttaaccatcgccgttgcagccttgtatgcacttccaaatatctacggtgaa
gatccagctatccaaataacaggggcgcgtggcgcctctgttgatatgtcaacgctggat
gctgtcaccgatgcgctcaataaagcgcaactctcccaaaaatccattgctcttgaaaat
ggctcaatccttgttcgtttcaatgatacggatacgcaaatcagcgcccgagatatcatc
agtgaagcgttaggtaaggataaaatcgtcgcgttaaacctcgctccttcaacgccatat
tggctagagtcaattggtgctgcaccaatgaaactcggccttgatctgcgtggtggtgtg
cacttcctgatggaagtggatatggatgccgcgatggaaaaattggtcagccaacaagaa
gaagctttccgcagtgatctgcgtgacgagaaaattcgttaccgcgcgatccgtccatta
tcggatgcggttgaagtgaccctgcgtgatgccgagcagcttgcgcaaactaagctgctt
ctggagtcgaaacaccgtgatatgacctttacgacttcagaatccgatggccgttttgtg
ctcgtggctaagtttaccgaagctcgcttacaggaaattcgcaactacgccgttgagcag
aacatcactattttgcgtaaccgggtgaacgaactgggtgtggctgagcctctggttcaa
cgccaaggtgcgacacgtatcgtggtagagctgccgggtgtacaagatacagcgcgtgct
aaagaaatcttaggcgcgaccgcaacccttgaatttcgtgaagtggacgataaagccgac
cttgccgctgcggcagcaggacgtgcgcctgctggcagcgaaatcaagttcgatcgtaat
ggtcgtcctgtggtgctgaaaaagcgcgtgattctgggtggttcaagcattaccgatgca
agctcaagcgccgacgaatatggtcgcccacaggtgaacatttcgctcgatagcgaaggc
ggcaacaagatgtcagcgttctcgaaaaagaacattggcaagctgatggcgacggtgttt
gccgaatacaaagacagcggtaagcgctctcctgaaggtaaagtcattctgaccaagcat
gaagaagtgattaaccaagcgacgattcagtcggcattgggacgtaacttccgtattact
gggattgattcaccggcagaagcgcataaccttgctctgctattgcgtgccggtgctttg
attgcgccaatttctatcgtcgaagagcgcaccattggtccatcaatgggtcagcagaat
atcgatatgggtattcaggcctgtatttggggtatggtggcggtaatgctgtttacggtt
ctttactaccgtaagtttggcatgattgctaacatcgcactaatggcgaacctcgtgttg
atcattggcgtaatgtcgatgatcccgggcgcaaccatgaccttgccgggtattgctggt
atcgtgttgacggtcggtatggcggtcgatgccaacgtactgattttcgagcgtattcgt
gaagagctacgcgaaggaaaaaatccgcagcaagcgattcatcaaggttacgctaacgca
ttcagtaccattgccgatgccaacatcaccaccttaattacggcgatcattttgtttgcc
gttggtacaggggcgattaaaggcttcgcagtgacgctgtctatcggtattttaacctct
atgtttaccgcgattgtgggtacacgttgtatcgtgaacctgctgtatggcggcaaacgt
atcaacaaactgtcgatctga

KEGG   Vibrio cholerae O1 2012EL-2176: EN18_07105
Entry
EN18_07105        CDS       T03389                                 
Name
(GenBank) preprotein translocase subunit SecF
  KO
K03074  preprotein translocase subunit SecF
Organism
vcq  Vibrio cholerae O1 2012EL-2176
Pathway
vcq03060  Protein export
vcq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vcq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    EN18_07105
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EN18_07105
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcq02044]
    EN18_07105
Secretion system [BR:vcq02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   EN18_07105
SSDB
Motif
Pfam: SecD_SecF Sec_GG DUF3566 Peptidase_M19 Sterol-sensing DUF1673
Other DBs
NCBI-ProteinID: AIT28817
UniProt: A0A085QDP4
LinkDB
Position
1:270128..271075
AA seq 315 aa
MFQILKADKMIDFMRWSKFAFALSLVMIAASIFTLSTKWLNWGLDFTGGTLIEVGFEQPA
NLEQIRSALEAKGFGDATVQNFGSARDVMVRLRPRDDMAGEALGNQILAAIKEGTGGNVE
MRRIEFVGPNVGDELTEAGGLAILVSLLCILLYVSVRFEWRLAAGAVLALAHDVIITLGI
FSILQIEVDLTIVAALLTVVGYSLNDTIVVFDRIRENFRKMRKEEPAEIMNSSITQTLSR
TLITSGTTLFVVIALFTQGGAMIHGFALALLLGITVGTYSSIYVASALALKLGITREHLL
PPQVEKEGAELDEMP
NT seq 948 nt   +upstreamnt  +downstreamnt
atgtttcaaatcctaaaagcagacaaaatgatcgactttatgcgttggtcgaaattcgcc
ttcgccttgtcgctggtgatgattgccgcatcgatttttactctgtctaccaagtggctc
aactgggggctggatttcacgggcggtactttgattgaagtgggctttgaacagcctgcc
aatctggagcaaatccgtagcgcccttgaagcgaaaggttttggtgatgctaccgtgcaa
aactttggttctgcacgtgatgtgatggtacgtctacgtcctcgtgatgatatggcgggt
gaggcgttgggtaaccagatcctcgcggcgatcaaagaaggtaccggcggcaacgtggaa
atgcgccgtatcgaattcgttggcccgaacgtgggtgatgagctcactgaagcgggcggc
ttggcgattctggtttctttgctgtgtatcttgctttacgtgtcagtacgctttgaatgg
cgtttggctgcaggtgcggtgctggcattggcgcacgacgtcatcattaccttaggcatc
ttctctatcttacagattgaagttgatctcacgattgttgcagcattgctgacggttgtg
ggttactcacttaacgataccattgtggtgtttgaccggatccgtgaaaacttccgtaag
atgcgcaaagaagaacccgcagagatcatgaatagctcaattacacaaactttgagccgt
actttgatcacttcaggtaccactttgtttgtggtgattgccctctttactcaaggtgga
gcaatgatccacggttttgcgctggccttgttgctgggtattaccgttggtacttattct
tctatttatgtggcatcagcactggcgctgaaactcgggatcacccgtgagcacttattg
cctccacaagtagagaaagaaggcgcagagttggatgaaatgccgtag

DBGET integrated database retrieval system