KEGG   Vibrio cholerae O1 2012EL-2176: EN18_06145
Entry
EN18_06145        CDS       T03389                                 
Name
(GenBank) preprotein translocase subunit SecG
  KO
K03075  preprotein translocase subunit SecG
Organism
vcq  Vibrio cholerae O1 2012EL-2176
Pathway
vcq02024  Quorum sensing
vcq03060  Protein export
vcq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vcq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    EN18_06145
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EN18_06145
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    EN18_06145
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcq02044]
    EN18_06145
Secretion system [BR:vcq02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   EN18_06145
SSDB
Motif
Pfam: SecG
Other DBs
NCBI-ProteinID: AIT28634
UniProt: A0A085Q9C9
LinkDB
Position
1:62251..62586
AA seq 111 aa
MFTVLLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFA
TVFFVISLVLGNMSTHKTESQWVDPSQGQVIQQAGDSVSEAPAKSSDEIPQ
NT seq 336 nt   +upstreamnt  +downstreamnt
atgtttacagttctacttgtgatttacctgttggcagcggttgctatcattggcctagtg
ttgattcaacaaggtaaaggcgcagacatgggagcctcattcggtgctggcgcgtcaaac
acagtgtttggtgctagcggctcaggtaacttcctaacccgaatgactgcgattttcgca
acagtattttttgttatcagtcttgtgcttggcaatatgtcaactcacaaaactgaatca
caatgggttgacccttcacaaggtcaagtgattcagcaagctggtgactcagtgagtgaa
gcgcctgctaaaagtagtgacgaaattcctcaataa

DBGET integrated database retrieval system