KEGG   Vibrio cholerae O1 2012EL-2176: EN18_15015
Entry
EN18_15015        CDS       T03389                                 
Symbol
secA
Name
(GenBank) preprotein translocase subunit SecA
  KO
K03070  preprotein translocase subunit SecA [EC:7.4.2.8]
Organism
vcq  Vibrio cholerae O1 2012EL-2176
Pathway
vcq02024  Quorum sensing
vcq03060  Protein export
vcq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vcq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    EN18_15015 (secA)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EN18_15015 (secA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    EN18_15015 (secA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcq02044]
    EN18_15015 (secA)
Enzymes [BR:vcq01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     EN18_15015 (secA)
Secretion system [BR:vcq02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   EN18_15015 (secA)
SSDB
Motif
Pfam: SecA_DEAD SecA_SW SecA_PP_bind SEC-C DEAD DUF2175 Helicase_C baeRF_family11 MEDS CorA
Other DBs
NCBI-ProteinID: AIT30334
UniProt: A0A0H5Y4Z5
LinkDB
Position
1:complement(2030943..2033654)
AA seq 903 aa
MITKLLTKVIGSRNDRTLRRLRKIVKEINNYEPAFEALSDEELKAKTVEFRQRIEQGENL
DQLLPEAFATVREASKRVFGMRHFDVQLIGGMVLHGGQIAEMRTGEGKTLTATLAAYLNA
LPGKGVHIVTVNDYLAKRDAETNRPLFEFLGMTVGVNIPNMPQPAKKEAYQADILYGTNN
EFGFDYLRDNMAFRPEDRVQRARFFAVVDEVDSILIDEARTPLIISGPAEDSSDLYIRIN
KLIPLLQKQDKEDSEEYRGDGHFTVDEKSKQVHLTETGQEFVEELLVKNGMMQEGDTLYS
PANISLLHHVNAALRAHVLFEKNVDYIVTPDGEVVIVDEHTGRTMPGRRWSDGLHQAVEA
KEGVKIQNENQTLASITFQNYFRLYEKLSGMTGTADTEAFEFQQIYGLETVVIPTNKPMV
RNDMPDVVYRSEAEKFAAIIEDIKQRVEKGQPVLVGTVSIEKSELLSNALKKAGIKHNVL
NAKFHEKEAEIVAEAGKPGAVTIATNMAGRGTDIVLGGSWQAKVEKLDNPTQEQIDAIKA
EWKQVHDQVLQAGGLHIIGTERHESRRIDNQLRGRSGRQGDAGSSRFYLSMEDTLLRIFT
SDRMAALIQSGMDEGEAIESKMLSRSIEKAQRKVEGRNFDIRKQLLEYDDVANDQRKVVY
ELRDELMSADDISDMIAQNREDVLNAVMDEYIPPQSLEDMWDIKGLEDRLKNDFDLPLPI
QSWLDADNKLYEEALRERIIEQAVEVYKAKEQAVSPAVMRNFEKSVMLQTLDTLWKEHLA
AMDHLRQGIHLRGYAQKNPKQEYKRESFELFEDLLESLKSDVITVLSKVRVQQQEEVERM
EAQRRAQAEEAARHAQAQHASADDAEQDESNQPMVRDERKVGRNEPCPCGSGKKYKQCHG
QIN
NT seq 2712 nt   +upstreamnt  +downstreamnt
atgataactaagctactgacaaaggtgattggcagtcgcaatgaccgcacactgcgccgt
ttacgcaagattgtaaaagagattaataactacgaacccgcctttgaagccctctccgat
gaagagctaaaagcgaaaactgtcgagttccgtcaacgcattgaacagggcgaaaacctt
gatcaactgttgccagaagcttttgccaccgtgcgcgaagcttctaagcgtgtgttcggc
atgcgccattttgatgtacagctgattggcggtatggtgctgcatggcggtcaaatcgct
gagatgcgtacgggtgaaggtaaaacgctaaccgcaacgctggctgcttacctgaatgcc
ctacctggcaaaggcgtacacattgttacggtcaacgactacttggccaaacgtgacgca
gaaaccaaccgaccactcttcgaattcttaggcatgaccgtgggtgtgaatattcccaac
atgccgcagcctgctaaaaaagaggcttaccaagccgacatcctgtacggcaccaacaac
gaatttggttttgactacctgcgcgataacatggcgtttcgccctgaagatcgcgtgcaa
cgtgctcgcttctttgctgtggtcgatgaagtggactcaatcttaatcgatgaagcacgt
accccgctgattatctcaggtcctgcggaagacagttcggatctctacatccgtatcaac
aagttgatcccgctactgcaaaagcaagataaagaagattcggaagagtaccgcggtgac
ggtcacttcaccgtggatgaaaaatctaagcaggtgcatctgaccgaaacgggtcaagag
ttcgttgaagagctgctagtgaaaaacggcatgatgcaagagggtgatacgctttactct
cccgctaacattagcttgctgcaccacgttaacgcggcattacgtgcgcatgttctgttt
gaaaagaacgtcgattacatcgtgacacccgatggtgaagtggtgatcgttgatgaacat
accggtcgtactatgccgggtcgtcgctggtctgatggtctgcaccaagcggtagaagca
aaagaaggggtgaagatccagaacgaaaaccaaactctggcttcgatcactttccaaaac
tacttccgtctgtatgaaaagctgtctggtatgacgggtaccgctgataccgaagcgttt
gaattccaacaaatttatggtttggaaacagttgttattccaaccaacaagccgatggtg
cgtaacgatatgccggatgtggtgtatcgctctgaggcggaaaagtttgccgcgatcatt
gaagatatcaaacagcgtgttgagaaaggtcaacctgtgttggtgggtacggtttcgatt
gagaaatcagaattgctctccaatgcactgaaaaaagcaggcatcaagcacaatgttctg
aacgcgaagttccatgaaaaagaagcggaaattgttgctgaagccggtaaacctggcgca
gtcaccatcgcaactaacatggcgggtcgtggtacggatatcgtattgggtggcagctgg
caagccaaagtggagaagctggacaacccaacccaagagcaaattgatgcgattaaagct
gagtggaagcaagtgcacgatcaagtgttgcaagcgggcggcctacacatcattggtact
gagcgtcacgaatctcgccgtatcgataaccagctacgtggtcgttctggtcgtcaaggt
gatgcgggttcatcgcgtttctatctctcaatggaagatactttactgcgtattttcacc
tctgatcgtatggcggcattgatccaaagcggtatggatgaaggcgaagcgattgagtca
aaaatgctctctcgctcgattgaaaaagcgcagcgtaaagtagaaggccgtaacttcgac
attcgtaaacagttgctggaatacgatgacgtagcgaacgatcagcgtaaagtcgtttac
gaactgcgtgatgaactgatgagcgcagatgacatcagcgacatgatcgcgcaaaaccgt
gaagatgtgctgaacgcggtgatggatgagtacattccgccacaatctctggaagatatg
tgggatatcaaagggttggaagatcgcctaaagaacgatttcgatctaccactaccgatc
caatcttggttagatgctgacaacaagctgtatgaagaagcgctacgtgagcgcatcatc
gagcaagcggttgaggtttataaagccaaagagcaagcggttagccctgcggtgatgcgt
aactttgaaaaatctgtgatgctgcaaacgctagatacactgtggaaagagcatctggcg
gcgatggatcacttgcgtcaaggtattcatctacgtggttacgcacagaaaaacccgaaa
caagagtacaagcgcgagtcgtttgaactgtttgaagatctgcttgagtcactcaaatcg
gatgtgatcactgtcttgtccaaagtccgtgttcagcagcaagaagaagtggagcgtatg
gaagctcaacgccgcgcgcaagctgaagaagcggcgcgtcatgcacaagcgcaacacgcg
agtgctgatgatgctgagcaagacgagtcgaaccagccaatggtgcgtgatgaacgcaaa
gtgggccgtaacgaaccttgtccatgcggtagcggtaaaaaatacaaacagtgtcacggg
caaattaactaa

DBGET integrated database retrieval system