KEGG   Vibrio cholerae O1 2012EL-2176: EN18_15350
Entry
EN18_15350        CDS       T03389                                 
Name
(GenBank) signal peptidase
  KO
K03100  signal peptidase I [EC:3.4.21.89]
Organism
vcq  Vibrio cholerae O1 2012EL-2176
Pathway
vcq03060  Protein export
Brite
KEGG Orthology (KO) [BR:vcq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    EN18_15350
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:vcq01002]
    EN18_15350
Enzymes [BR:vcq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.89  signal peptidase I
     EN18_15350
Peptidases and inhibitors [BR:vcq01002]
 Serine peptidases
  Family S26: signal peptidase I family
   EN18_15350
SSDB
Motif
Pfam: Peptidase_S26 PepSY_TM Saf_2TM
Other DBs
NCBI-ProteinID: AIT30399
UniProt: A0A0H5WJI0
LinkDB
Position
1:complement(2114754..2115650)
AA seq 298 aa
MANTFSLILVIVTLVTGIVWTLEKLVWAKKRQQKQAHLQAQTPDMPASALDKVVAQPWWI
ENSVSIFPVIAFVLVLRSFIYEPFQIPSGSMMPTLLVGDFILVEKYAYGLKDPVWRTQLV
ETGKPERGDIVVFKYPVNPEIDYIKRVVGMPGDTVRYSAGKELCIQHQGESECQAVKLSN
VQESEFYQNEIPLIQLNEQLGKVEHNILVNPLSIDNVANYRPRSGVNEWVVPQGHYFVMG
DNRDNSADSRFWGFVPEQNLVGKAVAIWISFEFERAEDSVLPRWIPTGVRFNRVGGIH
NT seq 897 nt   +upstreamnt  +downstreamnt
atggcgaacacattctcactgattttggtgatcgtaactctggtcaccggtatcgtctgg
acactggaaaagctggtgtgggcgaaaaaacgccaacagaaacaagctcatttacaggcg
caaacgcccgatatgccagcctcagcgctggataaagtcgtggctcagccgtggtggatt
gaaaacagtgtctcgattttccctgttattgcttttgtgctggtactgcgctcgttcatt
tatgaaccgttccaaattccatccggttcgatgatgccgactctgctggtcggggatttt
attctggttgagaaatacgcttacggcttgaaagatcctgtatggcgcactcagttagtg
gaaacgggtaaacctgagcgtggtgatattgtggtgttcaaatacccagtgaaccctgag
atcgactacatcaaacgtgtggtggggatgcccggagataccgtacgttacagcgcaggt
aaagagctgtgtattcagcaccaaggcgagagcgaatgccaagcagttaaactctctaac
gtgcaagagagcgagttttaccaaaatgagatccccctgatccagctgaacgaacagcta
ggtaaggttgagcacaatattttggttaacccattgagcattgataacgtggcgaattat
cgcccacgcagtggcgtgaatgaatgggttgtaccacaagggcactattttgtgatgggt
gataaccgtgacaacagtgctgacagccgtttctggggctttgtgccagagcagaatctg
gtcggaaaagctgtggctatctggatcagtttcgagtttgaacgcgctgaagacagcgta
cttccacgctggattcctaccggagtacgattcaatcgtgttggtgggatccactaa

DBGET integrated database retrieval system