KEGG   Vibrio cholerae O1 2012EL-2176: EN18_17095
Entry
EN18_17095        CDS       T03389                                 
Name
(GenBank) twin-arginine protein translocation system subunit TatC
  KO
K03118  sec-independent protein translocase protein TatC
Organism
vcq  Vibrio cholerae O1 2012EL-2176
Pathway
vcq03060  Protein export
vcq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vcq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    EN18_17095
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EN18_17095
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcq02044]
    EN18_17095
Secretion system [BR:vcq02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein
   EN18_17095
SSDB
Motif
Pfam: TatC
Other DBs
NCBI-ProteinID: AIT30729
UniProt: A0A085R4Q1
LinkDB
Position
1:complement(2468339..2469091)
AA seq 250 aa
MSSVEQTQPLISHLLELRNRLLKAVAAVVVIFIGLIYFSNEIYEFVSKPLVERLPAGATM
IATDVASPFFTPLKLTLIAAVFLAVPFILYQVWAFVAPGLYKHERRLIFPLLVSSSLLFY
CGVAFAYFVVFPLVFGFFTAISLGGVEFATDIASYLDFVLALFLAFGIAFEVPVAIILLC
WTGATTPKSLSEKRPYIIVGAFVVGMLLTPPDMISQTLLAIPMCLLFEVGLFFARFYTRD
EADEGQEEEE
NT seq 753 nt   +upstreamnt  +downstreamnt
atgtcttccgttgaacagacccaacctttgatcagccatttgttggaactgcgtaatcgc
ctactcaaagcggtggcggctgtggtggtgatatttattggcttgatctatttctcgaat
gaaatttacgagtttgtctcaaaacccctagtcgagcgacttcccgcgggcgcaaccatg
attgcgaccgatgtggcttcaccctttttcacgcctttaaaactgacgttgattgccgcg
gtgtttctcgcggtgcctttcattttgtatcaggtgtgggcttttgtggctcccggttta
tataagcacgaacggcgtttaatcttcccactgctggtctctagctcgctgctgttttac
tgcggtgtcgcgtttgcctattttgtggtgtttccgctggtgtttggatttttcaccgcc
atttcactcggtggtgtggagttcgcgaccgatatcgcgagttatctcgattttgtattg
gcgctgtttctagcctttggtatcgcgtttgaagtgccagttgcgatcattctgctgtgc
tggacgggcgcaaccacgcctaaaagcctatcggaaaagcgtccatacattatcgttggt
gcgtttgtagttggtatgttactgacgccgccggatatgatttcgcaaacgctactcgcc
atacctatgtgcttgttgtttgaagttggtttgttcttcgctcgtttttatacccgtgat
gaagccgatgaaggacaagaggaagaagaataa

DBGET integrated database retrieval system