KEGG   Vibrio cholerae O1 2012EL-2176: EN18_17525
Entry
EN18_17525        CDS       T03389                                 
Name
(GenBank) membrane protein insertase
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
vcq  Vibrio cholerae O1 2012EL-2176
Pathway
vcq02024  Quorum sensing
vcq03060  Protein export
vcq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vcq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    EN18_17525
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EN18_17525
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    EN18_17525
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:vcq03029]
    EN18_17525
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcq02044]
    EN18_17525
Mitochondrial biogenesis [BR:vcq03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    EN18_17525
Secretion system [BR:vcq02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   EN18_17525
SSDB
Motif
Pfam: YidC_periplas 60KD_IMP DUF2427
Other DBs
NCBI-ProteinID: AIT30807
UniProt: A0A0H6DJ22
LinkDB
Position
1:2550706..2552331
AA seq 541 aa
MDSQRNILLIALALVSFLLFQQWQVAKNPAPQATQQAQSTGAAPAPSFSDELDPTPAQNV
AAKAKTITVSTDVLTLSIDTLGGDVVSAKLNQYSEELNSPESFVLLQNTQGHQFIAQSGL
VGPQGIDVTSNNRPAYQVSADSFTLAEGQDELRIPMTYQANGIDYTKTFILKRGSYAVDV
VFDVANNSGSEATLGMYAHLRQNLLDSGGNLAMPTYRGGAYSTSDVRYKKYSFDDMKDRN
LSAPNDVTVNWVAMIQHYFASAWIPRDEPQAQLYSRVINNLGDMGIRTPNKTIANGDKAE
FEATLWVGPKLQDQMAATAPNLDLVVDYGWLWFIAKPLHWLLSVIQTFVGNWGVAIICLT
FIVRGAMYPLTKAQYTSMAKMRMLQPKLQAMRERIGDDRQRMSQEMMELYKKEKVNPLGG
CLPILLQMPIFIALYWALMESVELRHSPFFGWIHDLSAQDPYYILPLLMGASMFVIQKMS
PTTITDPMQQKIMTFMPVMFTFFFLWFPSGLVLYWLVSNIVTLIQQTLIYKALEKKGLHS
K
NT seq 1626 nt   +upstreamnt  +downstreamnt
atggattctcaacgtaatatcttgttaatcgctctggcgctggtttctttcctactgttt
caacaatggcaagtagcgaagaaccctgcaccgcaagcgacacagcaggcccaatccaca
ggcgcagctcctgctccttcattttccgatgagttagatccaacgcctgcacaaaatgtg
gcggcgaaggccaagaccattaccgtctcaaccgatgtactgactctgtctattgatacg
ctcggcggcgatgtggttagcgcaaaactgaatcaatactcagaagagctcaattcgcct
gagtcttttgtcttgttgcaaaacacccaaggccatcagtttattgctcaaagtggttta
gtcggcccacaaggcattgacgtcaccagcaataatcgtcccgcttaccaagtgagtgcg
gatagtttcactctggccgaaggccaagatgaactgcgcattcctatgacctatcaagcc
aatggcattgactacacgaaaaccttcattcttaagcgtggtagctacgccgtggatgtg
gtgtttgacgtcgccaataattcaggtagcgaagccacactaggtatgtatgctcacctg
cgccaaaatctgctggattctggtggcaacctcgccatgccaacttaccgtggtggtgct
tactcaaccagcgatgtgcgttacaagaagtacagcttcgacgacatgaaagatcgcaac
ctcagtgcaccaaacgatgtgacggtaaactgggtcgcgatgatccagcactacttcgct
tcagcatggatcccacgtgatgagccgcaagcacagctttactcacgcgttatcaataat
ttaggtgatatgggtatccgtacaccaaacaaaaccattgccaacggtgataaagcagag
tttgaagcaaccttatgggtaggcccaaaactgcaagaccaaatggccgcaacagcccct
aatcttgatctggtggttgattatggttggttgtggttcattgctaagccactgcactgg
ttgctgtctgtgattcagacctttgttggcaactggggtgtggccatcatctgcttaacc
tttattgttcgtggtgcgatgtacccactgaccaaagcacagtacacctcaatggcgaaa
atgcgcatgctgcaacctaaactgcaagcgatgcgtgagcggattggcgatgatcgccag
cgcatgagccaagagatgatggagctgtataagaaagagaaagtaaacccactgggtggc
tgtctccctatccttctgcaaatgccgattttcattgcgctgtactgggcactgatggag
tcggtagagctgcgtcactctccattctttggttggattcatgacttgtccgcgcaagat
ccttactacatcttgccactgctgatgggtgcgagcatgttcgttatccagaagatgagc
ccgaccacgatcaccgatccaatgcaacagaagatcatgaccttcatgccagtcatgttc
actttcttcttcctgtggttcccatcaggtctggttctgtactggttggtgtcgaacatc
gtaacgctaatccagcaaacgctgatctacaaagcgctagagaaaaaaggcttacactcc
aagtaa

DBGET integrated database retrieval system