KEGG   Vibrio cholerae O1 2012EL-2176: EN18_18500
Entry
EN18_18500        CDS       T03389                                 
Name
(GenBank) preprotein translocase subunit SecE
  KO
K03073  preprotein translocase subunit SecE
Organism
vcq  Vibrio cholerae O1 2012EL-2176
Pathway
vcq02024  Quorum sensing
vcq03060  Protein export
vcq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vcq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    EN18_18500
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EN18_18500
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    EN18_18500
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcq02044]
    EN18_18500
Secretion system [BR:vcq02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   EN18_18500
SSDB
Motif
Pfam: SecE
Other DBs
NCBI-ProteinID: AIT30976
UniProt: A0A086SMC6
LinkDB
Position
1:2761419..2761799
AA seq 126 aa
MKANNAEAPDSSNAADTLKWVATFVLLVAAVVGNYLYGELSVVARAAGVIVLIAAALGVA
ATTTKGKEAIVFARESRMEVRKVVWPTRQETMQTTLIVLAVSIVMALALWGIDGIMVRLV
AFATGV
NT seq 381 nt   +upstreamnt  +downstreamnt
atgaaagcaaacaacgctgaagctcctgatagctcaaatgcagcagacactctaaagtgg
gtagccacttttgttctgctggttgccgctgttgtgggtaattacctgtatggtgaactg
tctgtggtggctcgcgccgcaggtgtaattgtgttgattgctgcagcacttggtgttgct
gcgacaacaacaaaaggcaaagaagcgatcgtttttgctcgcgaatctcgcatggaagtt
cgcaaagtagtttggccaacacgccaagaaactatgcaaaccacgctgatcgttttagca
gtaagtattgtaatggctctggcgctttggggtattgacggcattatggttcgtctagtg
gcctttgcgaccggagtatag

DBGET integrated database retrieval system