KEGG   Vibrio cholerae O1 2012EL-2176: EN18_19800
Entry
EN18_19800        CDS       T03389                                 
Name
(GenBank) signal recognition particle
  KO
K03106  signal recognition particle subunit SRP54 [EC:3.6.5.4]
Organism
vcq  Vibrio cholerae O1 2012EL-2176
Pathway
vcq02024  Quorum sensing
vcq03060  Protein export
vcq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vcq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    EN18_19800
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EN18_19800
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    EN18_19800
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcq02044]
    EN18_19800
Enzymes [BR:vcq01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.4  signal-recognition-particle GTPase
     EN18_19800
Secretion system [BR:vcq02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   EN18_19800
  Eukaryotic Sec-SRP protein
   EN18_19800
SSDB
Motif
Pfam: SRP54 SRP_SPB SRP54_N CbiA Zeta_toxin AAA_22 cobW AAA_30 KTI12 AAA_24 DO-GTPase1 Helicase_RecD AAA_33 Mg_chelatase AAA_31 APS_kinase T2SSE AAA_18 AAA_16 YqeC Rad17 ATP_bind_1 DUF3867 Thymidylate_kin Nup88
Other DBs
NCBI-ProteinID: AIT31189
UniProt: A0A0H6SJZ8
LinkDB
Position
1:3017467..3018852
AA seq 461 aa
MFENLTDRLSKTLKNISGKGRLTEDNIKDTLREVRMALLEADVALPVVRDFVNRVKEGAV
GVEVSKSLTPGQEFIKIVRQQLEAVMGESNEALNLAAQPPAVILMAGLQGAGKTTSVGKL
SKLLKERDKKKVLVVSADVYRPAAIKQLETLANDLGVDFFPSTPDQKPIDIANAAIDHAK
KKFYDVLIVDTAGRLAIDEQMMAEIQALHKAINPVETLFVVDAMTGQDAADTAKAFGDAL
PLTGVILTKVDGDARGGAALSVRHITGKPIKFIGVGEKTDALEPFHPDRIASRILGMGDV
LSLIEDLQRNVDQEKAEKLAKKFKEKKGFDLEDFREQLGQMKNMGGMMGMLDKLPGMSQL
PADMKDKVDDRVFKQMEAIINSMTMKERQNPDLIKGSRKKRIAAGSGTQVQDVNRLLKQF
TQMQKMMKKMQQGGMKGMMRNMQGLMGGGGRGGFGGGFFGR
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtttgagaatttaaccgatcgattgtccaaaacgctgaaaaatatcagcggcaaaggt
cgtcttactgaagacaacattaaagataccctgcgcgaagtgcgcatggcgctgttagag
gcggacgttgcgctgcctgtcgttcgtgatttcgtcaatcgcgttaaagaaggcgcggtg
ggggtcgaggtttccaaatctctgactccgggtcaagagttcatcaaaatcgtccgccag
caacttgaagctgtgatgggcgaatccaacgaagcgttgaatcttgccgctcagcctcca
gcggttattttgatggctggtttgcaaggtgcgggtaaaaccacatccgtaggcaaactc
tctaagctcctaaaagagcgtgataagaagaaagtgttggtggtttccgccgacgtgtat
cgcccagcggcgatcaagcagctcgaaacattagccaatgatttaggcgttgatttcttc
ccgtccacaccggatcaaaaaccgattgatatcgctaacgctgcaattgatcacgctaag
aagaaattctacgacgtactgattgtcgataccgcaggtcgtttggcgattgatgagcag
atgatggcggagatccaagcgctgcataaagcgatcaatccggttgaaaccctgttcgtg
gtcgatgccatgacgggtcaagatgccgccgataccgcgaaagcgtttggtgatgcattg
ccactgaccggggtgattctaaccaaggtcgatggtgatgcccgtggcggtgcggcgttg
tcggtacgccatattaccggtaaaccgattaaatttatcggtgtcggcgagaaaaccgat
gccttagagcctttccatccggatcgtattgcttcacgcattcttggtatgggcgatgta
ctgtcgctgatcgaagatctgcagcgcaatgttgaccaagagaaagccgaaaaactcgcg
aaaaaattcaaagagaagaaaggctttgatttagaagactttcgtgagcagttaggtcag
atgaaaaacatgggcggcatgatggggatgctcgataaactgcccggaatgtctcaactg
cctgcggatatgaaagacaaagtggatgatcgcgttttcaaacagatggaagccatcatc
aactcaatgaccatgaaagagcgtcaaaacccagacctcatcaaaggctcacgcaaaaag
cggattgctgcgggttccggtacccaagtgcaagacgtaaaccgcctgctcaagcaattt
acccagatgcagaagatgatgaagaaaatgcaacaaggtggcatgaaaggcatgatgcgt
aacatgcaaggcctgatgggcggcggtggccgtggtggtttcggcggcggtttcttcggt
cgttaa

DBGET integrated database retrieval system