KEGG   Vollenhovia emeryi: 105558699
Entry
105558699         CDS       T06016                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
vem  Vollenhovia emeryi
Pathway
vem00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:vem00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    105558699
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:vem00199]
    105558699
Enzymes [BR:vem01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     105558699
Cytochrome P450 [BR:vem00199]
 Cytochrome P450, animal type
  CYP306 family
   105558699
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 105558699
NCBI-ProteinID: XP_011861917
LinkDB
Position
Unknown
AA seq 487 aa
MIAFIILSVSLVLLVYVFFYKNRKLRLPPGPCGIPLLGYLPWLDPVRPHVSLTELARKYG
PVCGLRMGSVYTVLLSDPQLVRQTFAKDAFAGRAPLYLTHGIMKGYGLICAEGDRWRAQR
RFVTGCLKNFGMTKLPGARRDNMEQRIVAAVNECTSKFKKRTMEDGIDPLETLHHCVGNM
MNDLVFGKVYKEDDELWKWLRHMQEEGVKHIGVAGPLNFLPFLRFLPRYGKVMELLVDGQ
LKTHQVYQKIIDEHRARREKTDNFLAAFDEAMSTNADNGYFTQPQFYHLLADLFGAGTDT
TLTTFRWFLLFMAAYPDEQKKIQAEMDELLGQKPPTLEDRPLLIRLEAAIVETQRLRSVV
PVGIPHGTIEDTQIGDYDIPKNTMVVPLQWAIHTDPLYWHEPHLFKPERFITEDGNLGKP
KAFLPYQAGKRMCVGDELAKMILFLFAARFLHSFVISVPSGTRIDLEGECGITLVPKPHR
LIFTPRD
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgatagcctttattatcctgagcgtgtcgctcgtgcttcttgtctacgtcttcttttat
aaaaatcgcaaacttcgacttccgccgggaccctgcgggatcccactgctcggttatcta
ccatggctagaccccgtccgtcctcacgtgtcgctgacggaactggcgaggaaatatggc
ccggtttgtggtctacggatgggttctgtgtacaccgtattgttatcggatccacagctg
gtaaggcagacctttgccaaggatgcgtttgccggccgggcgccattgtacctgacgcac
ggaataatgaagggatacggcctcatttgcgccgaaggtgaccgttggcgagcgcaaaga
agatttgtgaccggatgcctgaaaaatttcggcatgacgaaattacccggtgccaggagg
gacaatatggaacaaagaatcgtcgcggccgtgaacgagtgcacgtcgaaatttaaaaag
cgtaccatggaagacggtatcgatccgctcgagacacttcatcattgcgtgggtaacatg
atgaacgacctcgtgttcggtaaagtttacaaggaggacgacgagttgtggaaatggtta
agacatatgcaagaggaaggagttaagcatattggagtcgcagggccgctcaactttttg
ccatttctcagatttttgccacgatacggcaaagtgatggagctgcttgtcgatggccaa
ttaaaaacgcatcaagtatatcaaaagattatcgacgagcatcgcgctcgacgcgagaaa
acagataatttccttgcggctttcgacgaggcgatgagtaccaatgcggataatggatac
ttcacacagccgcaattttatcatctgctagccgatctttttggcgcaggcaccgacaca
actcttacgacatttcgctggttcctgctctttatggcagcatatccggacgagcaaaaa
aaaattcaggctgaaatggacgagctgttgggtcaaaagccacccactttggaagacagg
ccacttttaattcgactggaagcggccattgtagagacgcaaagattgcgaagcgtagtg
ccggttggcatccctcatggaacgatagaggatactcagataggcgattacgatatacca
aagaataccatggtcgttccattacaatgggccattcacacggatccgttatactggcac
gagccccatttattcaaacctgagagatttattaccgaggacggaaacctcggaaaacca
aaagcctttttgccgtatcaagcaggcaaacgtatgtgcgtcggtgacgaactagccaag
atgatattgtttctgttcgccgcaagatttcttcattcattcgttatctccgtaccatcc
ggtactcgtatcgatctcgagggcgagtgtggaattaccctggtaccgaaaccgcaccgc
ttgatttttacaccgcgggactaa

DBGET integrated database retrieval system